Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7WL91

Protein Details
Accession A0A2B7WL91    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-104ARDCLREQNKSRKRKRGQQEKDHSRKRQRVSNEHLRSBasic
NLS Segment(s)
PositionSequence
77-97KSRKRKRGQQEKDHSRKRQRV
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
Amino Acid Sequences MVKPIGGYWAACATTQRKFHPQLRRVAYAGCRRSPDAACHVSLTSGVVKPIGDDQPTYLPIDWLPDNARDCLREQNKSRKRKRGQQEKDHSRKRQRVSNEHLRSLHSYRRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.33
4 0.38
5 0.45
6 0.52
7 0.6
8 0.63
9 0.66
10 0.67
11 0.66
12 0.59
13 0.56
14 0.56
15 0.54
16 0.53
17 0.47
18 0.43
19 0.4
20 0.43
21 0.4
22 0.37
23 0.34
24 0.31
25 0.29
26 0.27
27 0.26
28 0.21
29 0.2
30 0.17
31 0.12
32 0.1
33 0.09
34 0.08
35 0.08
36 0.08
37 0.11
38 0.11
39 0.09
40 0.09
41 0.1
42 0.12
43 0.13
44 0.13
45 0.11
46 0.09
47 0.09
48 0.11
49 0.1
50 0.1
51 0.1
52 0.13
53 0.14
54 0.16
55 0.17
56 0.15
57 0.17
58 0.25
59 0.28
60 0.32
61 0.38
62 0.48
63 0.56
64 0.65
65 0.73
66 0.75
67 0.79
68 0.82
69 0.86
70 0.86
71 0.88
72 0.89
73 0.91
74 0.91
75 0.93
76 0.93
77 0.92
78 0.91
79 0.89
80 0.85
81 0.81
82 0.8
83 0.79
84 0.79
85 0.81
86 0.77
87 0.76
88 0.71
89 0.67
90 0.63
91 0.58
92 0.58