Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7XS15

Protein Details
Accession A0A2B7XS15    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-33SYLVQRIRSARLRRKRSNRPEIGPPTDHydrophilic
NLS Segment(s)
PositionSequence
16-23ARLRRKRS
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MGCGCISYLVQRIRSARLRRKRSNRPEIGPPTDFRRVEFVLPISDTDDFSMDEKPTYNYRVVRPLPKSRTQKIKDEAQKLKYRMAEVGLRRRLWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.55
4 0.61
5 0.69
6 0.75
7 0.84
8 0.88
9 0.9
10 0.91
11 0.89
12 0.84
13 0.84
14 0.81
15 0.77
16 0.68
17 0.59
18 0.54
19 0.53
20 0.48
21 0.38
22 0.36
23 0.3
24 0.28
25 0.28
26 0.23
27 0.16
28 0.17
29 0.16
30 0.12
31 0.11
32 0.1
33 0.09
34 0.09
35 0.08
36 0.08
37 0.09
38 0.08
39 0.08
40 0.09
41 0.11
42 0.12
43 0.14
44 0.17
45 0.19
46 0.21
47 0.29
48 0.32
49 0.38
50 0.42
51 0.5
52 0.52
53 0.59
54 0.65
55 0.64
56 0.71
57 0.67
58 0.7
59 0.66
60 0.7
61 0.69
62 0.71
63 0.72
64 0.69
65 0.74
66 0.67
67 0.67
68 0.6
69 0.53
70 0.45
71 0.42
72 0.41
73 0.41
74 0.49
75 0.5