Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XFM5

Protein Details
Accession A0A2B7XFM5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-82EDGSNLRKKKTRKKTKDKEEEDDEEAcidic
NLS Segment(s)
PositionSequence
64-73RKKKTRKKTK
Subcellular Location(s) cyto_nucl 10.333, cyto 10, nucl 9.5, cyto_mito 8.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MCAADVGLRFTCGHREPKAWLVPCETTNCQSFAVQKWEDADHCCHFCYVSLSAALEIEDGSNLRKKKTRKKTKDKEEEDDEEEEKEGKGTGRLCGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.35
4 0.42
5 0.49
6 0.46
7 0.43
8 0.41
9 0.41
10 0.4
11 0.41
12 0.36
13 0.31
14 0.29
15 0.29
16 0.24
17 0.23
18 0.23
19 0.21
20 0.25
21 0.23
22 0.21
23 0.22
24 0.22
25 0.22
26 0.22
27 0.23
28 0.19
29 0.19
30 0.19
31 0.17
32 0.16
33 0.15
34 0.15
35 0.12
36 0.1
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.06
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.1
49 0.11
50 0.14
51 0.2
52 0.29
53 0.39
54 0.51
55 0.61
56 0.67
57 0.78
58 0.87
59 0.92
60 0.95
61 0.92
62 0.89
63 0.85
64 0.8
65 0.72
66 0.64
67 0.54
68 0.44
69 0.36
70 0.29
71 0.21
72 0.16
73 0.13
74 0.11
75 0.14
76 0.15