Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XYM5

Protein Details
Accession A0A2B7XYM5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-32LVLEPGKRKKSSRKPQGPKKREPLATTHydrophilic
NLS Segment(s)
PositionSequence
11-26GKRKKSSRKPQGPKKR
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MPYRSLVLEPGKRKKSSRKPQGPKKREPLATTFSCLFCNHENCVTVKLDKKLGLGNLSCKICGQRFQTGINYLSAAVDVYSDWIDACDAVAKDTVDRDEDFESPRPAERPTARDTLDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.76
4 0.79
5 0.8
6 0.83
7 0.9
8 0.96
9 0.94
10 0.93
11 0.91
12 0.89
13 0.83
14 0.76
15 0.71
16 0.66
17 0.59
18 0.53
19 0.45
20 0.37
21 0.33
22 0.29
23 0.26
24 0.24
25 0.24
26 0.23
27 0.22
28 0.23
29 0.22
30 0.25
31 0.23
32 0.21
33 0.22
34 0.22
35 0.23
36 0.22
37 0.22
38 0.22
39 0.21
40 0.21
41 0.18
42 0.19
43 0.21
44 0.21
45 0.2
46 0.18
47 0.18
48 0.16
49 0.21
50 0.21
51 0.21
52 0.23
53 0.25
54 0.28
55 0.28
56 0.29
57 0.24
58 0.21
59 0.15
60 0.13
61 0.11
62 0.08
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.08
75 0.08
76 0.09
77 0.1
78 0.1
79 0.11
80 0.13
81 0.14
82 0.13
83 0.13
84 0.15
85 0.16
86 0.18
87 0.21
88 0.23
89 0.25
90 0.24
91 0.27
92 0.26
93 0.26
94 0.33
95 0.35
96 0.36
97 0.38
98 0.44