Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Z568

Protein Details
Accession A0A2B7Z568    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-27SENYRDLYRRAKDRRRAKPAAAHydrophilic
NLS Segment(s)
PositionSequence
16-23AKDRRRAK
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MSLLVSENYRDLYRRAKDRRRAKPAAAAFWTSILAPGPQQPPVDDDRRRVDLHVSILTGNRPQRQVDYVEYKRASRYTPQGKQEAIDQVQAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.5
3 0.58
4 0.67
5 0.76
6 0.84
7 0.84
8 0.83
9 0.77
10 0.76
11 0.71
12 0.67
13 0.59
14 0.5
15 0.41
16 0.35
17 0.31
18 0.22
19 0.17
20 0.11
21 0.08
22 0.07
23 0.11
24 0.11
25 0.13
26 0.14
27 0.14
28 0.16
29 0.2
30 0.26
31 0.23
32 0.26
33 0.28
34 0.31
35 0.31
36 0.29
37 0.27
38 0.23
39 0.24
40 0.21
41 0.17
42 0.14
43 0.15
44 0.16
45 0.18
46 0.19
47 0.19
48 0.2
49 0.21
50 0.22
51 0.24
52 0.26
53 0.28
54 0.34
55 0.34
56 0.4
57 0.41
58 0.4
59 0.4
60 0.39
61 0.36
62 0.33
63 0.4
64 0.43
65 0.49
66 0.55
67 0.57
68 0.56
69 0.54
70 0.53
71 0.52
72 0.43