Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P0K3

Protein Details
Accession J3P0K3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-36GGREKKDEEAKKERRRWGSRKRRRSVLGQBasic
NLS Segment(s)
PositionSequence
9-31GREKKDEEAKKERRRWGSRKRRR
Subcellular Location(s) mito 10cyto 10cyto_mito 10
Family & Domain DBs
Amino Acid Sequences MSGLGEGGGREKKDEEAKKERRRWGSRKRRRSVLGQPTPHGLDFGVFVWVKQQFSSNLAAAAAAAAGGVGAQHGSSCRAFLKCFPAITGCVGGRTCPREIFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.49
4 0.6
5 0.68
6 0.76
7 0.8
8 0.81
9 0.84
10 0.85
11 0.86
12 0.87
13 0.87
14 0.9
15 0.89
16 0.87
17 0.81
18 0.8
19 0.79
20 0.79
21 0.77
22 0.69
23 0.63
24 0.57
25 0.54
26 0.45
27 0.35
28 0.23
29 0.14
30 0.11
31 0.1
32 0.1
33 0.08
34 0.08
35 0.1
36 0.12
37 0.12
38 0.11
39 0.12
40 0.1
41 0.12
42 0.15
43 0.12
44 0.11
45 0.11
46 0.1
47 0.09
48 0.08
49 0.05
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.06
62 0.06
63 0.08
64 0.11
65 0.13
66 0.14
67 0.17
68 0.24
69 0.25
70 0.25
71 0.25
72 0.25
73 0.25
74 0.26
75 0.27
76 0.21
77 0.21
78 0.2
79 0.21
80 0.25
81 0.28
82 0.28