Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7X4J4

Protein Details
Accession A0A2B7X4J4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-46QTPKVEPQEKKKTPKGRAKKRLQYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) cyto 10, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRLQYTRRFVNVTMTGGKRKVRLFLLLASRILYITHEGTVAQKEVNIPRQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.49
5 0.51
6 0.6
7 0.62
8 0.67
9 0.68
10 0.7
11 0.73
12 0.74
13 0.77
14 0.77
15 0.78
16 0.77
17 0.81
18 0.82
19 0.82
20 0.85
21 0.88
22 0.88
23 0.89
24 0.9
25 0.88
26 0.86
27 0.82
28 0.8
29 0.74
30 0.65
31 0.55
32 0.51
33 0.44
34 0.37
35 0.34
36 0.27
37 0.25
38 0.26
39 0.28
40 0.26
41 0.25
42 0.27
43 0.24
44 0.26
45 0.25
46 0.28
47 0.32
48 0.3
49 0.3
50 0.27
51 0.25
52 0.22
53 0.2
54 0.15
55 0.12
56 0.11
57 0.11
58 0.1
59 0.1
60 0.12
61 0.15
62 0.15
63 0.12
64 0.12
65 0.17
66 0.23