Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Y871

Protein Details
Accession A0A2B7Y871    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-108NGEVTTPKKPRKPRAKTPKTPKTPKKVNEVNEHydrophilic
NLS Segment(s)
PositionSequence
83-102PKKPRKPRAKTPKTPKTPKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGVKWDDTIDRRLLLSTIDPATKPNWEDVAKAMGEDFTSEACRQRFGKLKRDIVGEGVGSLSPKKRKADENNGTGENGEVTTPKKPRKPRAKTPKTPKTPKKVNEVNEGPEPEEAKPVTEEANDTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.17
5 0.18
6 0.18
7 0.18
8 0.2
9 0.22
10 0.21
11 0.2
12 0.22
13 0.21
14 0.22
15 0.23
16 0.25
17 0.21
18 0.2
19 0.17
20 0.12
21 0.11
22 0.11
23 0.09
24 0.06
25 0.09
26 0.09
27 0.14
28 0.14
29 0.17
30 0.17
31 0.22
32 0.31
33 0.33
34 0.43
35 0.47
36 0.52
37 0.51
38 0.53
39 0.48
40 0.4
41 0.36
42 0.26
43 0.18
44 0.13
45 0.1
46 0.07
47 0.08
48 0.1
49 0.12
50 0.16
51 0.18
52 0.21
53 0.29
54 0.38
55 0.48
56 0.53
57 0.54
58 0.54
59 0.53
60 0.5
61 0.41
62 0.32
63 0.21
64 0.14
65 0.09
66 0.06
67 0.07
68 0.12
69 0.18
70 0.24
71 0.32
72 0.41
73 0.51
74 0.62
75 0.7
76 0.76
77 0.81
78 0.86
79 0.9
80 0.92
81 0.92
82 0.92
83 0.93
84 0.91
85 0.9
86 0.89
87 0.85
88 0.84
89 0.81
90 0.76
91 0.75
92 0.7
93 0.64
94 0.61
95 0.56
96 0.47
97 0.41
98 0.38
99 0.28
100 0.29
101 0.24
102 0.19
103 0.19
104 0.19
105 0.18
106 0.17