Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8UUN1

Protein Details
Accession J8UUN1   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-47ANGKGTKKVLKARAKPPGKKRGALNARAKPPGKKGKRGRWQPAGHBasic
79-105SVWSAKNLKNQPRVPKRVRKKGKLKKKBasic
NLS Segment(s)
PositionSequence
6-42KGTKKVLKARAKPPGKKRGALNARAKPPGKKGKRGRW
84-105KNLKNQPRVPKRVRKKGKLKKK
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences RSANGKGTKKVLKARAKPPGKKRGALNARAKPPGKKGKRGRWQPAGHELPGDMPANYRYCGQSIIAKLKNKVKFKLHESVWSAKNLKNQPRVPKRVRKKGKLKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.8
4 0.83
5 0.84
6 0.85
7 0.8
8 0.77
9 0.72
10 0.72
11 0.71
12 0.71
13 0.71
14 0.68
15 0.68
16 0.7
17 0.67
18 0.6
19 0.6
20 0.62
21 0.58
22 0.6
23 0.65
24 0.69
25 0.77
26 0.83
27 0.82
28 0.81
29 0.79
30 0.73
31 0.73
32 0.65
33 0.55
34 0.45
35 0.36
36 0.27
37 0.25
38 0.21
39 0.11
40 0.08
41 0.1
42 0.11
43 0.12
44 0.12
45 0.1
46 0.1
47 0.11
48 0.12
49 0.14
50 0.16
51 0.23
52 0.28
53 0.3
54 0.34
55 0.4
56 0.47
57 0.48
58 0.51
59 0.51
60 0.52
61 0.55
62 0.6
63 0.54
64 0.54
65 0.54
66 0.55
67 0.5
68 0.5
69 0.46
70 0.4
71 0.47
72 0.48
73 0.52
74 0.54
75 0.59
76 0.64
77 0.72
78 0.79
79 0.81
80 0.84
81 0.86
82 0.87
83 0.92
84 0.91
85 0.92