Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7XRJ7

Protein Details
Accession A0A2B7XRJ7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-74SRKFEPGRKRAKEARAKGRHBasic
NLS Segment(s)
PositionSequence
56-75RKFEPGRKRAKEARAKGRHA
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019626  Stress-induced_KGG_rpt  
Pfam View protein in Pfam  
PF10685  KGG  
Amino Acid Sequences MSSSSRNPANFANCPTEEVSEIDRKGEQASHSSGFASMDPDKQHEIASKVGQTSSRKFEPGRKRAKEARAKGRHAASSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.32
4 0.27
5 0.25
6 0.24
7 0.23
8 0.23
9 0.21
10 0.2
11 0.19
12 0.19
13 0.19
14 0.16
15 0.14
16 0.17
17 0.17
18 0.17
19 0.16
20 0.16
21 0.14
22 0.13
23 0.13
24 0.1
25 0.12
26 0.12
27 0.13
28 0.14
29 0.14
30 0.15
31 0.14
32 0.15
33 0.15
34 0.16
35 0.16
36 0.15
37 0.16
38 0.2
39 0.21
40 0.24
41 0.28
42 0.28
43 0.3
44 0.31
45 0.4
46 0.46
47 0.53
48 0.59
49 0.59
50 0.65
51 0.71
52 0.79
53 0.8
54 0.79
55 0.8
56 0.79
57 0.79
58 0.78
59 0.76