Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7YHG2

Protein Details
Accession A0A2B7YHG2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-29YYDPKCIRCFKPRKVINHRQRFMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027310  Profilin_CS  
Gene Ontology GO:0003779  F:actin binding  
PROSITE View protein in PROSITE  
PS00414  PROFILIN  
Amino Acid Sequences MSTWDYYYDPKCIRCFKPRKVINHRQRFMICASCRLAVSWAEPGDIPYEPKNVSIGITPDLYRDHLLGLRPDRLSADIIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.63
4 0.71
5 0.73
6 0.77
7 0.8
8 0.85
9 0.85
10 0.86
11 0.79
12 0.74
13 0.68
14 0.6
15 0.52
16 0.49
17 0.39
18 0.32
19 0.32
20 0.27
21 0.26
22 0.24
23 0.22
24 0.14
25 0.14
26 0.13
27 0.11
28 0.1
29 0.1
30 0.1
31 0.11
32 0.1
33 0.11
34 0.09
35 0.12
36 0.12
37 0.12
38 0.13
39 0.11
40 0.12
41 0.12
42 0.12
43 0.12
44 0.13
45 0.13
46 0.13
47 0.14
48 0.15
49 0.15
50 0.13
51 0.13
52 0.14
53 0.17
54 0.22
55 0.25
56 0.29
57 0.28
58 0.29
59 0.28
60 0.28