Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7X725

Protein Details
Accession A0A2B7X725    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-33LTRLATRACRPHCRLVRRPPTTIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003788  NDUFAF7  
IPR038375  NDUFAF7_sf  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0035243  F:protein-arginine omega-N symmetric methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF02636  Methyltransf_28  
Amino Acid Sequences MNNGPAQLLLLTRLATRACRPHCRLVRRPPTTILQRCNSTLPPSSPSVPPPPPQQQRQWSTPLAKTITDAINVTGPISIAAFMRQCLTSPDGGYYTSRGKDSAGTEVFGRKGDFITSPEISQIFGELLGVWTVAEWIAQGRRKTGVEIIEVGPGKGTLMADMLRSFRNFKTFANSIEAVYLVEASPVLRDVQKQLLCGDAPMEEVDIGYKSTSTHLGVPVIWTEHIRFLPQGEDKTPFIFAHEFFDALPIHAFQSVAPDPSQTIMTPTGPTALHHTTPASTPQWRELVVSPNPESESKKEPEFRLSIAKASTPNSLVIPEISPRYKALKDTPGSTIEVSPESQSWVQEFARRIGGPNPPRSDAKTTATTTPTQTPTQRQPSGAALILDYGTMSTIPINSLRGIQKHKLVSPFTAPGEVDLSADVDFTALAEAAIEASPGVEVYGPMEQGDLLQTLGIEERAKQLLRKEVGDGDEERRRTIESGWKRLVERGGGGMGKIYKAMAIVPESGGKRRPVGFGGGIRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.24
4 0.31
5 0.38
6 0.48
7 0.54
8 0.62
9 0.7
10 0.77
11 0.8
12 0.82
13 0.85
14 0.81
15 0.8
16 0.74
17 0.74
18 0.75
19 0.74
20 0.7
21 0.66
22 0.64
23 0.61
24 0.61
25 0.54
26 0.49
27 0.46
28 0.41
29 0.39
30 0.39
31 0.4
32 0.38
33 0.4
34 0.43
35 0.42
36 0.44
37 0.48
38 0.55
39 0.6
40 0.64
41 0.69
42 0.7
43 0.72
44 0.73
45 0.71
46 0.67
47 0.65
48 0.61
49 0.59
50 0.51
51 0.44
52 0.4
53 0.39
54 0.34
55 0.29
56 0.26
57 0.2
58 0.2
59 0.19
60 0.18
61 0.13
62 0.11
63 0.09
64 0.09
65 0.08
66 0.06
67 0.09
68 0.09
69 0.09
70 0.12
71 0.11
72 0.12
73 0.15
74 0.17
75 0.17
76 0.17
77 0.19
78 0.18
79 0.19
80 0.2
81 0.19
82 0.22
83 0.21
84 0.21
85 0.2
86 0.19
87 0.22
88 0.23
89 0.28
90 0.24
91 0.23
92 0.23
93 0.26
94 0.26
95 0.23
96 0.22
97 0.14
98 0.14
99 0.15
100 0.15
101 0.14
102 0.19
103 0.19
104 0.18
105 0.2
106 0.19
107 0.18
108 0.16
109 0.14
110 0.09
111 0.07
112 0.07
113 0.05
114 0.06
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.03
123 0.05
124 0.11
125 0.16
126 0.17
127 0.18
128 0.22
129 0.23
130 0.24
131 0.26
132 0.24
133 0.21
134 0.24
135 0.23
136 0.24
137 0.24
138 0.22
139 0.18
140 0.15
141 0.13
142 0.11
143 0.1
144 0.05
145 0.06
146 0.07
147 0.07
148 0.09
149 0.1
150 0.11
151 0.12
152 0.15
153 0.15
154 0.2
155 0.2
156 0.2
157 0.26
158 0.26
159 0.27
160 0.3
161 0.3
162 0.25
163 0.24
164 0.23
165 0.15
166 0.14
167 0.12
168 0.05
169 0.05
170 0.04
171 0.04
172 0.04
173 0.05
174 0.06
175 0.06
176 0.07
177 0.1
178 0.17
179 0.19
180 0.19
181 0.19
182 0.2
183 0.19
184 0.18
185 0.16
186 0.09
187 0.08
188 0.07
189 0.07
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.06
199 0.08
200 0.08
201 0.1
202 0.11
203 0.11
204 0.11
205 0.12
206 0.11
207 0.1
208 0.1
209 0.09
210 0.08
211 0.1
212 0.11
213 0.11
214 0.1
215 0.1
216 0.14
217 0.16
218 0.17
219 0.15
220 0.18
221 0.18
222 0.19
223 0.2
224 0.15
225 0.15
226 0.15
227 0.13
228 0.14
229 0.14
230 0.13
231 0.11
232 0.14
233 0.12
234 0.1
235 0.1
236 0.07
237 0.07
238 0.07
239 0.07
240 0.05
241 0.1
242 0.1
243 0.11
244 0.11
245 0.1
246 0.1
247 0.11
248 0.12
249 0.06
250 0.08
251 0.08
252 0.09
253 0.09
254 0.09
255 0.1
256 0.1
257 0.1
258 0.14
259 0.14
260 0.14
261 0.14
262 0.15
263 0.13
264 0.14
265 0.17
266 0.14
267 0.15
268 0.15
269 0.18
270 0.19
271 0.18
272 0.19
273 0.18
274 0.22
275 0.22
276 0.25
277 0.23
278 0.22
279 0.24
280 0.24
281 0.24
282 0.21
283 0.24
284 0.23
285 0.26
286 0.3
287 0.3
288 0.33
289 0.32
290 0.3
291 0.31
292 0.3
293 0.28
294 0.23
295 0.24
296 0.21
297 0.22
298 0.22
299 0.16
300 0.16
301 0.14
302 0.14
303 0.12
304 0.11
305 0.1
306 0.1
307 0.12
308 0.12
309 0.13
310 0.14
311 0.18
312 0.18
313 0.2
314 0.24
315 0.29
316 0.3
317 0.32
318 0.34
319 0.32
320 0.32
321 0.3
322 0.25
323 0.18
324 0.17
325 0.15
326 0.13
327 0.11
328 0.13
329 0.12
330 0.12
331 0.12
332 0.14
333 0.14
334 0.18
335 0.19
336 0.18
337 0.22
338 0.22
339 0.23
340 0.24
341 0.32
342 0.35
343 0.41
344 0.42
345 0.41
346 0.43
347 0.45
348 0.47
349 0.42
350 0.4
351 0.39
352 0.37
353 0.38
354 0.39
355 0.37
356 0.33
357 0.35
358 0.34
359 0.32
360 0.33
361 0.35
362 0.42
363 0.49
364 0.48
365 0.44
366 0.43
367 0.42
368 0.41
369 0.36
370 0.27
371 0.18
372 0.16
373 0.15
374 0.12
375 0.09
376 0.06
377 0.04
378 0.04
379 0.04
380 0.04
381 0.04
382 0.06
383 0.07
384 0.09
385 0.09
386 0.14
387 0.17
388 0.22
389 0.28
390 0.31
391 0.36
392 0.39
393 0.43
394 0.44
395 0.43
396 0.41
397 0.39
398 0.4
399 0.35
400 0.33
401 0.29
402 0.24
403 0.23
404 0.2
405 0.15
406 0.11
407 0.11
408 0.08
409 0.09
410 0.07
411 0.05
412 0.05
413 0.04
414 0.05
415 0.04
416 0.04
417 0.04
418 0.04
419 0.05
420 0.05
421 0.04
422 0.04
423 0.04
424 0.04
425 0.04
426 0.04
427 0.04
428 0.04
429 0.06
430 0.07
431 0.07
432 0.08
433 0.08
434 0.07
435 0.08
436 0.09
437 0.08
438 0.06
439 0.06
440 0.06
441 0.06
442 0.07
443 0.09
444 0.08
445 0.08
446 0.12
447 0.16
448 0.18
449 0.2
450 0.25
451 0.33
452 0.36
453 0.36
454 0.36
455 0.36
456 0.37
457 0.38
458 0.36
459 0.34
460 0.37
461 0.36
462 0.34
463 0.31
464 0.31
465 0.29
466 0.3
467 0.34
468 0.37
469 0.45
470 0.5
471 0.54
472 0.53
473 0.57
474 0.56
475 0.48
476 0.4
477 0.33
478 0.32
479 0.28
480 0.26
481 0.25
482 0.22
483 0.2
484 0.18
485 0.16
486 0.11
487 0.11
488 0.13
489 0.12
490 0.13
491 0.14
492 0.15
493 0.21
494 0.23
495 0.27
496 0.3
497 0.3
498 0.33
499 0.34
500 0.37
501 0.33
502 0.37
503 0.39