Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7X576

Protein Details
Accession A0A2B7X576    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-32SMSTARSPKKQPPLPKQPLSKPKPNSRPANPHydrophilic
NLS Segment(s)
PositionSequence
10-24KKQPPLPKQPLSKPK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSMSTARSPKKQPPLPKQPLSKPKPNSRPANPSANVADIQLKLKSSAPQPGPVPSIGSDNKQKDKEAQKISDSRRVIEFDSSCAPQPFLDGEEILRRMRAIRRGQEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.84
4 0.84
5 0.83
6 0.86
7 0.83
8 0.82
9 0.79
10 0.8
11 0.82
12 0.82
13 0.81
14 0.78
15 0.8
16 0.75
17 0.75
18 0.65
19 0.58
20 0.51
21 0.43
22 0.36
23 0.27
24 0.25
25 0.16
26 0.17
27 0.14
28 0.13
29 0.12
30 0.13
31 0.15
32 0.14
33 0.21
34 0.2
35 0.23
36 0.24
37 0.25
38 0.25
39 0.22
40 0.22
41 0.15
42 0.18
43 0.15
44 0.17
45 0.22
46 0.25
47 0.3
48 0.31
49 0.31
50 0.34
51 0.41
52 0.47
53 0.47
54 0.46
55 0.46
56 0.52
57 0.56
58 0.57
59 0.5
60 0.43
61 0.39
62 0.38
63 0.34
64 0.32
65 0.28
66 0.23
67 0.26
68 0.25
69 0.25
70 0.24
71 0.23
72 0.17
73 0.18
74 0.16
75 0.14
76 0.14
77 0.12
78 0.13
79 0.18
80 0.2
81 0.19
82 0.18
83 0.17
84 0.2
85 0.26
86 0.33
87 0.37