Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7YQY8

Protein Details
Accession A0A2B7YQY8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MIRSNRKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
65-80NRKKAAKAKAAAKKKA
Subcellular Location(s) mito 9plas 9, cyto 3, extr 3, E.R. 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLLVATAVFLYYTAWTLLMPFVDPGHPLHDLFPPRVWAIRIPVILTLLGSAVVGTLLGVVMIRSNRKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.09
11 0.09
12 0.11
13 0.12
14 0.12
15 0.13
16 0.17
17 0.18
18 0.19
19 0.19
20 0.18
21 0.18
22 0.19
23 0.18
24 0.14
25 0.15
26 0.17
27 0.16
28 0.15
29 0.15
30 0.14
31 0.13
32 0.12
33 0.08
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.04
48 0.07
49 0.14
50 0.17
51 0.21
52 0.29
53 0.33
54 0.41
55 0.48
56 0.57
57 0.6
58 0.65
59 0.72
60 0.75