Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Y9I5

Protein Details
Accession A0A2B7Y9I5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
182-290GSDRRRERSRDRGKERERDRRSRRHDDHDRDQKRDQDRERDRHDRRRHRSRSQDRERHRRKRSASRSRDVRQPDERDRDYRRRDRSRSPYERRRDHRRQGKHDDRDRKRBasic
NLS Segment(s)
PositionSequence
173-290REEKAARRGGSDRRRERSRDRGKERERDRRSRRHDDHDRDQKRDQDRERDRHDRRRHRSRSQDRERHRRKRSASRSRDVRQPDERDRDYRRRDRSRSPYERRRDHRRQGKHDDRDRKR
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MDLVAGVRKEGSRGGRDAFKWTDVKDSAHRENYLGHSVMAPVGRWQTGRDLSWYTKHDDGDDDAATEEEKANAARNARDEEIRQIKEAEQEALAKALGLPVALKSGGVGANANLIPLGGGEEVEKVVMDNAADDGDEQGARGIGFGGYGGGPTGAAGQDGGERLEGVGVYERREEKAARRGGSDRRRERSRDRGKERERDRRSRRHDDHDRDQKRDQDRERDRHDRRRHRSRSQDRERHRRKRSASRSRDVRQPDERDRDYRRRDRSRSPYERRRDHRRQGKHDDRDRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.39
4 0.44
5 0.42
6 0.41
7 0.39
8 0.37
9 0.4
10 0.36
11 0.39
12 0.4
13 0.45
14 0.47
15 0.5
16 0.5
17 0.43
18 0.45
19 0.45
20 0.42
21 0.35
22 0.27
23 0.22
24 0.22
25 0.23
26 0.19
27 0.15
28 0.13
29 0.14
30 0.15
31 0.15
32 0.16
33 0.21
34 0.24
35 0.25
36 0.25
37 0.28
38 0.3
39 0.36
40 0.37
41 0.35
42 0.35
43 0.34
44 0.32
45 0.29
46 0.29
47 0.25
48 0.23
49 0.19
50 0.15
51 0.15
52 0.14
53 0.12
54 0.1
55 0.07
56 0.07
57 0.07
58 0.1
59 0.12
60 0.14
61 0.16
62 0.18
63 0.22
64 0.23
65 0.25
66 0.24
67 0.3
68 0.36
69 0.35
70 0.33
71 0.31
72 0.3
73 0.32
74 0.32
75 0.25
76 0.17
77 0.17
78 0.16
79 0.15
80 0.14
81 0.09
82 0.08
83 0.07
84 0.06
85 0.05
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.04
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.08
98 0.08
99 0.08
100 0.07
101 0.06
102 0.05
103 0.05
104 0.06
105 0.03
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.04
112 0.03
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.08
155 0.08
156 0.09
157 0.12
158 0.13
159 0.14
160 0.16
161 0.17
162 0.19
163 0.27
164 0.31
165 0.3
166 0.32
167 0.36
168 0.44
169 0.51
170 0.56
171 0.56
172 0.59
173 0.64
174 0.67
175 0.7
176 0.71
177 0.73
178 0.74
179 0.74
180 0.77
181 0.79
182 0.83
183 0.85
184 0.85
185 0.83
186 0.83
187 0.83
188 0.83
189 0.84
190 0.86
191 0.83
192 0.83
193 0.85
194 0.83
195 0.84
196 0.84
197 0.81
198 0.76
199 0.74
200 0.71
201 0.67
202 0.68
203 0.63
204 0.63
205 0.67
206 0.71
207 0.75
208 0.78
209 0.79
210 0.81
211 0.85
212 0.85
213 0.86
214 0.88
215 0.89
216 0.88
217 0.91
218 0.91
219 0.92
220 0.92
221 0.92
222 0.91
223 0.93
224 0.93
225 0.93
226 0.91
227 0.89
228 0.87
229 0.89
230 0.9
231 0.89
232 0.88
233 0.88
234 0.88
235 0.84
236 0.83
237 0.79
238 0.76
239 0.74
240 0.73
241 0.72
242 0.72
243 0.71
244 0.71
245 0.73
246 0.75
247 0.76
248 0.77
249 0.78
250 0.79
251 0.81
252 0.84
253 0.86
254 0.87
255 0.88
256 0.89
257 0.89
258 0.89
259 0.92
260 0.9
261 0.9
262 0.9
263 0.9
264 0.9
265 0.9
266 0.9
267 0.91
268 0.92
269 0.92
270 0.92