Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7YC91

Protein Details
Accession A0A2B7YC91   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
327-346KKEKMERKRKLTALVSKPRRBasic
NLS Segment(s)
PositionSequence
161-214APKEKISKAKRRAMEAKQREQDAGKPKRPGAPSALEGTSGRLKDGKAGAGKARA
326-346AKKEKMERKRKLTALVSKPRR
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MSFLNSVLLSIETGDAAVTPPSVTRNPTPKPTPSVPKSAPPVAQSKPYYGSSQKRKAEDEIQPGNKPRKASRPSSPFWSSSQKSTPVPSAAARPRVTPQSTTPSATTKPSLTTAGKPLSKPAAAPPTKPPPKGSYAEMMLRAKQLQHKTPTQLGMIKHQSAPKEKISKAKRRAMEAKQREQDAGKPKRPGAPSALEGTSGRLKDGKAGAGKARAESEYKGTARPPRDPAVLEYKGTAGLASRRPGTNGSAQKQSHLQRSRSRTQDEYLGTDEEDEGDQYGDGEEEYYSDVSSDMEAGALDVETEEQEALRLARLEDERELRAELAAKKEKMERKRKLTALVSKPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.07
5 0.06
6 0.06
7 0.07
8 0.12
9 0.14
10 0.19
11 0.26
12 0.34
13 0.4
14 0.48
15 0.54
16 0.56
17 0.61
18 0.65
19 0.68
20 0.63
21 0.68
22 0.62
23 0.64
24 0.64
25 0.62
26 0.57
27 0.5
28 0.52
29 0.45
30 0.5
31 0.44
32 0.41
33 0.4
34 0.39
35 0.41
36 0.42
37 0.49
38 0.51
39 0.59
40 0.62
41 0.62
42 0.63
43 0.63
44 0.64
45 0.62
46 0.61
47 0.61
48 0.59
49 0.6
50 0.63
51 0.65
52 0.59
53 0.55
54 0.52
55 0.52
56 0.54
57 0.56
58 0.6
59 0.6
60 0.61
61 0.66
62 0.64
63 0.56
64 0.54
65 0.56
66 0.48
67 0.45
68 0.46
69 0.43
70 0.4
71 0.41
72 0.41
73 0.33
74 0.33
75 0.29
76 0.33
77 0.34
78 0.39
79 0.37
80 0.35
81 0.37
82 0.41
83 0.42
84 0.36
85 0.34
86 0.35
87 0.37
88 0.37
89 0.35
90 0.32
91 0.32
92 0.32
93 0.3
94 0.22
95 0.22
96 0.21
97 0.24
98 0.23
99 0.24
100 0.27
101 0.31
102 0.32
103 0.31
104 0.32
105 0.31
106 0.29
107 0.27
108 0.26
109 0.3
110 0.29
111 0.31
112 0.35
113 0.42
114 0.48
115 0.49
116 0.46
117 0.4
118 0.45
119 0.45
120 0.41
121 0.34
122 0.31
123 0.32
124 0.34
125 0.3
126 0.26
127 0.24
128 0.22
129 0.2
130 0.23
131 0.26
132 0.27
133 0.31
134 0.34
135 0.37
136 0.39
137 0.39
138 0.34
139 0.34
140 0.28
141 0.3
142 0.3
143 0.28
144 0.27
145 0.28
146 0.29
147 0.3
148 0.33
149 0.32
150 0.35
151 0.36
152 0.42
153 0.49
154 0.56
155 0.59
156 0.63
157 0.59
158 0.59
159 0.66
160 0.65
161 0.67
162 0.65
163 0.65
164 0.61
165 0.6
166 0.54
167 0.46
168 0.44
169 0.43
170 0.44
171 0.4
172 0.4
173 0.41
174 0.46
175 0.46
176 0.43
177 0.37
178 0.32
179 0.29
180 0.3
181 0.28
182 0.23
183 0.21
184 0.21
185 0.2
186 0.16
187 0.15
188 0.13
189 0.12
190 0.15
191 0.16
192 0.18
193 0.16
194 0.18
195 0.2
196 0.23
197 0.24
198 0.21
199 0.21
200 0.18
201 0.18
202 0.17
203 0.19
204 0.2
205 0.2
206 0.2
207 0.22
208 0.28
209 0.3
210 0.34
211 0.35
212 0.34
213 0.35
214 0.35
215 0.35
216 0.38
217 0.36
218 0.31
219 0.27
220 0.23
221 0.21
222 0.2
223 0.16
224 0.08
225 0.11
226 0.15
227 0.17
228 0.19
229 0.19
230 0.2
231 0.22
232 0.24
233 0.28
234 0.33
235 0.34
236 0.4
237 0.39
238 0.4
239 0.46
240 0.48
241 0.49
242 0.48
243 0.51
244 0.51
245 0.59
246 0.66
247 0.66
248 0.66
249 0.59
250 0.54
251 0.55
252 0.48
253 0.44
254 0.38
255 0.32
256 0.27
257 0.24
258 0.21
259 0.15
260 0.13
261 0.1
262 0.08
263 0.07
264 0.07
265 0.06
266 0.06
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.07
273 0.07
274 0.07
275 0.07
276 0.07
277 0.07
278 0.07
279 0.07
280 0.05
281 0.05
282 0.05
283 0.05
284 0.05
285 0.05
286 0.04
287 0.04
288 0.04
289 0.05
290 0.05
291 0.05
292 0.05
293 0.05
294 0.07
295 0.07
296 0.09
297 0.1
298 0.09
299 0.15
300 0.18
301 0.2
302 0.25
303 0.28
304 0.28
305 0.29
306 0.3
307 0.24
308 0.24
309 0.27
310 0.25
311 0.31
312 0.37
313 0.36
314 0.39
315 0.47
316 0.54
317 0.59
318 0.66
319 0.67
320 0.68
321 0.77
322 0.78
323 0.79
324 0.8
325 0.8
326 0.8