Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7XX36

Protein Details
Accession A0A2B7XX36    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AKGLRSTVRKHNKRVLRAAVHydrophilic
83-111SNSSSRRKDANRIKKVPKKARNKLTFAAHHydrophilic
NLS Segment(s)
PositionSequence
88-122RRKDANRIKKVPKKARNKLTFAAHPMKAKRLGKKA
Subcellular Location(s) mito 17.5, mito_nucl 13.833, nucl 9, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSTVRKHNKRVLRAAVYGPASDARTERLSAKLQELVSKPRETDMTDAAGESTDVNKTESKGEMEMDLDQPSTTIIAGSNSSSRRKDANRIKKVPKKARNKLTFAAHPMKAKRLGKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.79
4 0.73
5 0.68
6 0.62
7 0.58
8 0.5
9 0.42
10 0.34
11 0.27
12 0.22
13 0.19
14 0.17
15 0.15
16 0.15
17 0.17
18 0.17
19 0.19
20 0.22
21 0.23
22 0.25
23 0.25
24 0.24
25 0.28
26 0.29
27 0.31
28 0.31
29 0.3
30 0.28
31 0.25
32 0.26
33 0.22
34 0.22
35 0.18
36 0.16
37 0.15
38 0.15
39 0.13
40 0.12
41 0.1
42 0.08
43 0.07
44 0.05
45 0.06
46 0.07
47 0.07
48 0.08
49 0.1
50 0.1
51 0.11
52 0.11
53 0.11
54 0.1
55 0.1
56 0.11
57 0.1
58 0.1
59 0.09
60 0.08
61 0.07
62 0.07
63 0.06
64 0.05
65 0.04
66 0.04
67 0.05
68 0.06
69 0.07
70 0.11
71 0.14
72 0.18
73 0.19
74 0.21
75 0.27
76 0.3
77 0.39
78 0.46
79 0.55
80 0.61
81 0.69
82 0.78
83 0.8
84 0.88
85 0.88
86 0.87
87 0.87
88 0.87
89 0.89
90 0.87
91 0.85
92 0.81
93 0.78
94 0.74
95 0.71
96 0.68
97 0.61
98 0.59
99 0.56
100 0.55
101 0.56
102 0.57