Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7X8Y0

Protein Details
Accession A0A2B7X8Y0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-49VEKTTKACSRHQSNNFRRVPSSWHKPKGIDNRVRRRLKGHydrophilic
NLS Segment(s)
PositionSequence
42-46RVRRR
Subcellular Location(s) mito 14.5, cyto_mito 13.833, cyto 12, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVLASKHVPIVEKTTKACSRHQSNNFRRVPSSWHKPKGIDNRVRRRLKGSAAMPSIGYGSNKKTRHMMPSGHKAFLVHNVGDVELLTTHKGTHAAVIASGVSSRKRVEILEKAKSLGVKVTNPKGRVQAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.46
4 0.51
5 0.52
6 0.54
7 0.61
8 0.68
9 0.71
10 0.74
11 0.81
12 0.79
13 0.72
14 0.66
15 0.57
16 0.56
17 0.54
18 0.55
19 0.55
20 0.57
21 0.57
22 0.57
23 0.65
24 0.67
25 0.68
26 0.67
27 0.67
28 0.71
29 0.78
30 0.81
31 0.73
32 0.68
33 0.62
34 0.57
35 0.54
36 0.46
37 0.43
38 0.39
39 0.38
40 0.33
41 0.28
42 0.24
43 0.17
44 0.15
45 0.1
46 0.12
47 0.2
48 0.21
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.31
63 0.28
64 0.17
65 0.15
66 0.15
67 0.15
68 0.14
69 0.13
70 0.08
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.08
80 0.09
81 0.09
82 0.09
83 0.09
84 0.08
85 0.08
86 0.09
87 0.09
88 0.08
89 0.1
90 0.11
91 0.12
92 0.13
93 0.15
94 0.21
95 0.3
96 0.36
97 0.42
98 0.42
99 0.42
100 0.43
101 0.42
102 0.36
103 0.31
104 0.28
105 0.27
106 0.34
107 0.43
108 0.48
109 0.49
110 0.52
111 0.53