Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Y1P9

Protein Details
Accession A0A2B7Y1P9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
227-254APGKEATQRRREWKKKFPVRVQWDPERDHydrophilic
NLS Segment(s)
PositionSequence
236-241RREWKK
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025633  DUF4291  
Pfam View protein in Pfam  
PF14124  DUF4291  
Amino Acid Sequences MISRSTTTFCSRLYSGTPNYLPLPSGEVRAVVNLSLSHSSLNHQLRRVCLLQGGRPPGVLNSQNPQIFKLPLHNRQQLSRERPPLTTLSTPPSTPRTNLRMAEQQQHTTPSESPPRKAKKPTQAHSPPLPYPYRSIRAKYTPDTITVYQAYPPPIANAALRAGKFVAPPFKRGRMTWIKPSFLWMAYRCGYASKENQERVLAVEICRLGWEWALENACLSTVTPAAAPGKEATQRRREWKKKFPVRVQWDPERDLRFKPLAYRSLQVGLSGEAVDRYVDEWIVGITDVTEQMVRIGGLVEQGKLEEAMGEVPVEEVYPLPERLVGVIGASVEDAQGEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.39
4 0.39
5 0.37
6 0.38
7 0.36
8 0.32
9 0.25
10 0.27
11 0.2
12 0.22
13 0.19
14 0.18
15 0.18
16 0.19
17 0.19
18 0.13
19 0.13
20 0.1
21 0.13
22 0.13
23 0.13
24 0.13
25 0.13
26 0.15
27 0.23
28 0.31
29 0.32
30 0.35
31 0.38
32 0.39
33 0.44
34 0.44
35 0.36
36 0.33
37 0.33
38 0.33
39 0.38
40 0.41
41 0.35
42 0.34
43 0.33
44 0.29
45 0.32
46 0.29
47 0.25
48 0.24
49 0.31
50 0.33
51 0.33
52 0.34
53 0.31
54 0.29
55 0.27
56 0.33
57 0.35
58 0.41
59 0.49
60 0.54
61 0.53
62 0.56
63 0.63
64 0.62
65 0.62
66 0.62
67 0.62
68 0.57
69 0.56
70 0.54
71 0.5
72 0.46
73 0.41
74 0.35
75 0.32
76 0.31
77 0.31
78 0.31
79 0.33
80 0.3
81 0.28
82 0.33
83 0.32
84 0.36
85 0.37
86 0.39
87 0.42
88 0.43
89 0.5
90 0.46
91 0.43
92 0.39
93 0.4
94 0.37
95 0.31
96 0.29
97 0.25
98 0.33
99 0.33
100 0.36
101 0.42
102 0.48
103 0.53
104 0.6
105 0.63
106 0.64
107 0.71
108 0.73
109 0.74
110 0.74
111 0.73
112 0.71
113 0.67
114 0.58
115 0.53
116 0.49
117 0.39
118 0.36
119 0.35
120 0.36
121 0.34
122 0.35
123 0.36
124 0.4
125 0.44
126 0.42
127 0.42
128 0.36
129 0.35
130 0.37
131 0.32
132 0.28
133 0.25
134 0.22
135 0.18
136 0.19
137 0.18
138 0.15
139 0.14
140 0.12
141 0.11
142 0.12
143 0.1
144 0.09
145 0.1
146 0.12
147 0.12
148 0.11
149 0.11
150 0.11
151 0.12
152 0.12
153 0.19
154 0.17
155 0.22
156 0.25
157 0.3
158 0.31
159 0.31
160 0.37
161 0.39
162 0.42
163 0.47
164 0.48
165 0.45
166 0.43
167 0.46
168 0.39
169 0.3
170 0.3
171 0.21
172 0.21
173 0.2
174 0.2
175 0.17
176 0.17
177 0.17
178 0.17
179 0.21
180 0.24
181 0.29
182 0.3
183 0.31
184 0.3
185 0.29
186 0.27
187 0.27
188 0.2
189 0.14
190 0.15
191 0.14
192 0.14
193 0.14
194 0.12
195 0.09
196 0.08
197 0.08
198 0.07
199 0.1
200 0.11
201 0.1
202 0.1
203 0.09
204 0.09
205 0.08
206 0.07
207 0.06
208 0.05
209 0.06
210 0.05
211 0.07
212 0.09
213 0.08
214 0.09
215 0.09
216 0.12
217 0.17
218 0.22
219 0.27
220 0.34
221 0.4
222 0.49
223 0.6
224 0.67
225 0.71
226 0.76
227 0.81
228 0.83
229 0.87
230 0.87
231 0.87
232 0.86
233 0.87
234 0.84
235 0.82
236 0.76
237 0.69
238 0.66
239 0.61
240 0.54
241 0.46
242 0.44
243 0.38
244 0.34
245 0.38
246 0.38
247 0.38
248 0.38
249 0.38
250 0.35
251 0.36
252 0.35
253 0.29
254 0.23
255 0.18
256 0.16
257 0.14
258 0.12
259 0.08
260 0.08
261 0.07
262 0.06
263 0.06
264 0.06
265 0.06
266 0.06
267 0.06
268 0.05
269 0.06
270 0.06
271 0.05
272 0.04
273 0.05
274 0.06
275 0.06
276 0.06
277 0.06
278 0.06
279 0.07
280 0.07
281 0.06
282 0.07
283 0.06
284 0.1
285 0.11
286 0.11
287 0.11
288 0.11
289 0.11
290 0.11
291 0.11
292 0.07
293 0.06
294 0.07
295 0.07
296 0.07
297 0.06
298 0.06
299 0.06
300 0.06
301 0.06
302 0.05
303 0.08
304 0.11
305 0.12
306 0.12
307 0.13
308 0.13
309 0.14
310 0.15
311 0.12
312 0.09
313 0.1
314 0.09
315 0.08
316 0.08
317 0.07
318 0.06
319 0.06