Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Y2L5

Protein Details
Accession A0A2B7Y2L5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-41LTAWQKRKRASSNSPPARRTHydrophilic
NLS Segment(s)
PositionSequence
27-32KRKRAS
Subcellular Location(s) mito 15.5, nucl 10, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MVKVKSDFLVPASARKKLPLPLTAWQKRKRASSNSPPARRTRLQTQRHKTSAAVQDTTPSHSDNPISPPPEEEPSLLLEEHINIPTQERKELLSELADALKTDKVDAAFWACLQVCDIDRLRELISQAKAAPGLIPFLAAACHSLPRLWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.39
4 0.37
5 0.42
6 0.38
7 0.4
8 0.43
9 0.53
10 0.59
11 0.65
12 0.66
13 0.68
14 0.68
15 0.71
16 0.71
17 0.69
18 0.7
19 0.72
20 0.76
21 0.79
22 0.81
23 0.77
24 0.74
25 0.73
26 0.67
27 0.62
28 0.61
29 0.61
30 0.64
31 0.7
32 0.74
33 0.76
34 0.75
35 0.7
36 0.6
37 0.58
38 0.56
39 0.49
40 0.41
41 0.31
42 0.33
43 0.32
44 0.33
45 0.26
46 0.19
47 0.15
48 0.15
49 0.16
50 0.14
51 0.18
52 0.2
53 0.21
54 0.2
55 0.21
56 0.22
57 0.23
58 0.22
59 0.17
60 0.14
61 0.14
62 0.14
63 0.12
64 0.1
65 0.08
66 0.08
67 0.09
68 0.08
69 0.07
70 0.06
71 0.08
72 0.12
73 0.13
74 0.13
75 0.13
76 0.13
77 0.15
78 0.16
79 0.15
80 0.12
81 0.12
82 0.11
83 0.11
84 0.1
85 0.08
86 0.09
87 0.09
88 0.09
89 0.08
90 0.09
91 0.09
92 0.09
93 0.1
94 0.12
95 0.11
96 0.11
97 0.14
98 0.12
99 0.12
100 0.12
101 0.13
102 0.1
103 0.15
104 0.16
105 0.15
106 0.16
107 0.18
108 0.18
109 0.19
110 0.19
111 0.21
112 0.21
113 0.21
114 0.21
115 0.21
116 0.2
117 0.18
118 0.18
119 0.12
120 0.12
121 0.1
122 0.1
123 0.09
124 0.09
125 0.09
126 0.08
127 0.09
128 0.08
129 0.11
130 0.11