Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7YRG2

Protein Details
Accession A0A2B7YRG2   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
124-146GEEVEDRRKRWEKRNVRIWNQMAHydrophilic
NLS Segment(s)
PositionSequence
117-123KSKWRPS
128-138EDRRKRWEKRN
151-155RPKRK
Subcellular Location(s) mito 20.5, cyto_mito 11, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MSRTTHPGVATATSVSMKNRSFHSTSARLSESPAVERDDSAEPKPSPQPERKRENWQVQKEALKVKFQDGWHPKKKLSPDAMEGIRHLHAQDPERFSTPFLANEFKVPAEAIRRILKSKWRPSGEEVEDRRKRWEKRNVRIWNQMAEIGLRPKRKAFEKFSDAEKLDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.21
4 0.22
5 0.24
6 0.27
7 0.31
8 0.32
9 0.34
10 0.4
11 0.4
12 0.4
13 0.43
14 0.42
15 0.36
16 0.36
17 0.37
18 0.31
19 0.27
20 0.26
21 0.24
22 0.22
23 0.22
24 0.23
25 0.23
26 0.24
27 0.23
28 0.27
29 0.24
30 0.27
31 0.32
32 0.34
33 0.37
34 0.44
35 0.53
36 0.55
37 0.63
38 0.66
39 0.71
40 0.75
41 0.79
42 0.79
43 0.75
44 0.71
45 0.67
46 0.66
47 0.59
48 0.57
49 0.48
50 0.41
51 0.35
52 0.33
53 0.33
54 0.29
55 0.36
56 0.37
57 0.45
58 0.49
59 0.5
60 0.49
61 0.48
62 0.52
63 0.5
64 0.47
65 0.41
66 0.36
67 0.38
68 0.39
69 0.35
70 0.31
71 0.24
72 0.19
73 0.16
74 0.13
75 0.11
76 0.12
77 0.16
78 0.2
79 0.22
80 0.23
81 0.25
82 0.25
83 0.22
84 0.24
85 0.21
86 0.19
87 0.17
88 0.18
89 0.17
90 0.18
91 0.18
92 0.14
93 0.13
94 0.11
95 0.11
96 0.12
97 0.14
98 0.16
99 0.2
100 0.22
101 0.24
102 0.27
103 0.35
104 0.41
105 0.49
106 0.54
107 0.53
108 0.55
109 0.58
110 0.65
111 0.61
112 0.6
113 0.56
114 0.58
115 0.6
116 0.57
117 0.61
118 0.6
119 0.61
120 0.62
121 0.68
122 0.68
123 0.73
124 0.82
125 0.84
126 0.83
127 0.86
128 0.79
129 0.73
130 0.64
131 0.55
132 0.45
133 0.36
134 0.32
135 0.3
136 0.32
137 0.31
138 0.32
139 0.35
140 0.41
141 0.47
142 0.53
143 0.53
144 0.58
145 0.61
146 0.62
147 0.64
148 0.66
149 0.59