Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7X6X6

Protein Details
Accession A0A2B7X6X6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MATAKHVPIVKKHKKRFNRHQSDMFKCVPSSWRKPKGIDSRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
11-16KKHKKR
33-47RKPKGIDSRVRRRFK
Subcellular Location(s) mito 15.5, mito_nucl 10.5, cyto 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MATAKHVPIVKKHKKRFNRHQSDMFKCVPSSWRKPKGIDSRVRRRFKGQAAMPKIGYGSNAKTRHLIPSGHKVFVVKNTNDVDLLLMHNRTYAAEIAHAVSSGKRIAILAKAKALGVKVTNAQGRLTVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.9
3 0.92
4 0.92
5 0.92
6 0.89
7 0.9
8 0.89
9 0.86
10 0.81
11 0.72
12 0.63
13 0.52
14 0.45
15 0.42
16 0.41
17 0.44
18 0.48
19 0.54
20 0.56
21 0.59
22 0.67
23 0.7
24 0.71
25 0.71
26 0.7
27 0.72
28 0.78
29 0.81
30 0.74
31 0.69
32 0.67
33 0.63
34 0.62
35 0.57
36 0.57
37 0.57
38 0.57
39 0.51
40 0.44
41 0.38
42 0.29
43 0.24
44 0.16
45 0.14
46 0.2
47 0.21
48 0.21
49 0.23
50 0.23
51 0.25
52 0.25
53 0.25
54 0.2
55 0.29
56 0.31
57 0.3
58 0.29
59 0.27
60 0.25
61 0.3
62 0.33
63 0.23
64 0.25
65 0.26
66 0.27
67 0.26
68 0.25
69 0.18
70 0.12
71 0.13
72 0.1
73 0.09
74 0.08
75 0.09
76 0.09
77 0.09
78 0.1
79 0.09
80 0.07
81 0.08
82 0.09
83 0.1
84 0.1
85 0.09
86 0.08
87 0.08
88 0.09
89 0.09
90 0.08
91 0.07
92 0.08
93 0.09
94 0.16
95 0.21
96 0.22
97 0.24
98 0.24
99 0.25
100 0.26
101 0.25
102 0.21
103 0.18
104 0.18
105 0.19
106 0.24
107 0.28
108 0.27
109 0.27
110 0.27