Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NYR4

Protein Details
Accession J3NYR4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-149EQNARRKRIARRRKVLVMRINKMARNRKKTMTRRKGAMARTRDFAERRKRWLRKSRKARABasic
NLS Segment(s)
PositionSequence
93-149ARRKRIARRRKVLVMRINKMARNRKKTMTRRKGAMARTRDFAERRKRWLRKSRKARA
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 5
Family & Domain DBs
Amino Acid Sequences MVRPGYKCEICKKTKGVLNFKIRDSNYEIIKYICDRCHPCTQADAEEGCIVVCPWETVDDAVCVCNETFDAQWEAAVYEATASQVIREAEQNARRKRIARRRKVLVMRINKMARNRKKTMTRRKGAMARTRDFAERRKRWLRKSRKARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.65
4 0.65
5 0.71
6 0.68
7 0.66
8 0.66
9 0.61
10 0.56
11 0.52
12 0.47
13 0.41
14 0.38
15 0.36
16 0.28
17 0.3
18 0.29
19 0.27
20 0.24
21 0.27
22 0.3
23 0.34
24 0.43
25 0.43
26 0.41
27 0.4
28 0.4
29 0.36
30 0.34
31 0.29
32 0.21
33 0.19
34 0.18
35 0.13
36 0.11
37 0.08
38 0.06
39 0.05
40 0.04
41 0.04
42 0.05
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.06
55 0.06
56 0.07
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.04
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.06
72 0.07
73 0.07
74 0.08
75 0.1
76 0.16
77 0.23
78 0.32
79 0.33
80 0.37
81 0.39
82 0.43
83 0.52
84 0.57
85 0.62
86 0.64
87 0.69
88 0.72
89 0.8
90 0.82
91 0.81
92 0.79
93 0.77
94 0.7
95 0.7
96 0.66
97 0.6
98 0.61
99 0.63
100 0.63
101 0.62
102 0.64
103 0.64
104 0.71
105 0.78
106 0.81
107 0.82
108 0.79
109 0.76
110 0.8
111 0.78
112 0.76
113 0.75
114 0.72
115 0.65
116 0.61
117 0.58
118 0.56
119 0.53
120 0.53
121 0.55
122 0.53
123 0.59
124 0.66
125 0.72
126 0.76
127 0.83
128 0.86
129 0.86