Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XD33

Protein Details
Accession A0A2B7XD33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
31-50ALYRRLLRVHRKKLPQDMRFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006094  P:gluconeogenesis  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRISPRLLMATPSSIASKPGRPPVALLPPLALYRRLLRVHRKKLPQDMRFLGDEYVKSEFRAHRDVENPLHIVGFLKEWQLYAQKLEGGSWQGEKLDKEKIDKMSDQQLGQLYELMQALQKTGDGDGTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.22
4 0.25
5 0.28
6 0.36
7 0.37
8 0.35
9 0.38
10 0.41
11 0.47
12 0.42
13 0.37
14 0.3
15 0.28
16 0.3
17 0.28
18 0.22
19 0.15
20 0.17
21 0.23
22 0.25
23 0.3
24 0.39
25 0.49
26 0.57
27 0.64
28 0.7
29 0.7
30 0.76
31 0.81
32 0.74
33 0.71
34 0.64
35 0.58
36 0.51
37 0.45
38 0.35
39 0.26
40 0.22
41 0.16
42 0.17
43 0.14
44 0.13
45 0.16
46 0.16
47 0.19
48 0.22
49 0.21
50 0.21
51 0.23
52 0.26
53 0.25
54 0.25
55 0.23
56 0.19
57 0.17
58 0.15
59 0.13
60 0.09
61 0.09
62 0.07
63 0.07
64 0.07
65 0.07
66 0.09
67 0.11
68 0.11
69 0.11
70 0.11
71 0.12
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.11
79 0.11
80 0.13
81 0.14
82 0.15
83 0.2
84 0.21
85 0.24
86 0.29
87 0.33
88 0.36
89 0.37
90 0.38
91 0.4
92 0.42
93 0.38
94 0.36
95 0.35
96 0.32
97 0.3
98 0.27
99 0.19
100 0.17
101 0.17
102 0.14
103 0.12
104 0.11
105 0.11
106 0.1
107 0.1
108 0.09
109 0.1