Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XT62

Protein Details
Accession A0A2B7XT62   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
14-39WKIPWRLSSPQKARQRKRLRAVDQVVHydrophilic
74-103DKYTIFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
82-95KEKKYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLMGGLLWKIPWRLSSPQKARQRKRLRAVDQVVDTVSAALRNNGMTQTHAVDRWFTEMPREEEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.16
5 0.2
6 0.26
7 0.33
8 0.43
9 0.49
10 0.58
11 0.67
12 0.76
13 0.8
14 0.83
15 0.85
16 0.84
17 0.86
18 0.87
19 0.82
20 0.82
21 0.78
22 0.73
23 0.63
24 0.54
25 0.43
26 0.33
27 0.27
28 0.17
29 0.12
30 0.08
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.09
41 0.1
42 0.1
43 0.1
44 0.1
45 0.1
46 0.13
47 0.12
48 0.11
49 0.14
50 0.17
51 0.2
52 0.21
53 0.23
54 0.19
55 0.23
56 0.26
57 0.28
58 0.25
59 0.22
60 0.22
61 0.21
62 0.24
63 0.26
64 0.32
65 0.3
66 0.39
67 0.45
68 0.54
69 0.63
70 0.68
71 0.71
72 0.72
73 0.79
74 0.8
75 0.85
76 0.85
77 0.86
78 0.86
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.77
88 0.79