Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Z187

Protein Details
Accession A0A2B7Z187    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-128GIQVKEAPRQRKPRNSVGLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013262  OMP_MIM1/TOM13_mt  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
Pfam View protein in Pfam  
PF08219  TOM13  
Amino Acid Sequences MASEETPPRSRGELYDSTLTLPSDSENYSANNEISPSPPSSTESPLILYKPPTVWGLLRGAAINLLLPFVNGLMLGFGELLAHEAAFRLGWSGTKIFPSYRQTRPMGPGIQVKEAPRQRKPRNSVGLQDFTSLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.34
4 0.33
5 0.33
6 0.3
7 0.23
8 0.18
9 0.14
10 0.12
11 0.13
12 0.12
13 0.12
14 0.13
15 0.15
16 0.17
17 0.16
18 0.14
19 0.14
20 0.14
21 0.14
22 0.15
23 0.15
24 0.14
25 0.15
26 0.18
27 0.19
28 0.21
29 0.21
30 0.19
31 0.2
32 0.2
33 0.2
34 0.18
35 0.18
36 0.15
37 0.14
38 0.15
39 0.14
40 0.14
41 0.13
42 0.13
43 0.13
44 0.13
45 0.13
46 0.11
47 0.1
48 0.09
49 0.08
50 0.07
51 0.05
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.04
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.07
79 0.09
80 0.09
81 0.11
82 0.13
83 0.13
84 0.19
85 0.26
86 0.31
87 0.35
88 0.41
89 0.42
90 0.45
91 0.48
92 0.48
93 0.44
94 0.41
95 0.42
96 0.39
97 0.41
98 0.39
99 0.37
100 0.4
101 0.45
102 0.49
103 0.51
104 0.59
105 0.65
106 0.72
107 0.77
108 0.78
109 0.81
110 0.79
111 0.79
112 0.76
113 0.73
114 0.63