Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7YLW9

Protein Details
Accession A0A2B7YLW9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-62LYDILRRTLSRRKMRRRALRPSSRPRAEQHydrophilic
NLS Segment(s)
PositionSequence
42-59LSRRKMRRRALRPSSRPR
Subcellular Location(s) nucl 19, mito 6.5, cyto_mito 4.5
Family & Domain DBs
Amino Acid Sequences MKNNHIDLYFSPREKRLVGYLTLLWGSTRFGKTLYDILRRTLSRRKMRRRALRPSSRPRAEQATRSGENDSANAAILGNNNHLITNFRFPTAQPNDIICSLTYLPPPVRKRNAEPNIVFQQCVNPIWKTQSPTAPPAIADSPSSSRRTVPRSPNPQPAAAPKHKTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.35
4 0.32
5 0.31
6 0.3
7 0.28
8 0.27
9 0.26
10 0.23
11 0.17
12 0.14
13 0.14
14 0.16
15 0.16
16 0.14
17 0.15
18 0.16
19 0.18
20 0.25
21 0.29
22 0.31
23 0.31
24 0.33
25 0.39
26 0.39
27 0.41
28 0.43
29 0.47
30 0.5
31 0.6
32 0.68
33 0.72
34 0.82
35 0.88
36 0.88
37 0.89
38 0.89
39 0.9
40 0.89
41 0.89
42 0.89
43 0.82
44 0.75
45 0.67
46 0.65
47 0.58
48 0.52
49 0.48
50 0.45
51 0.42
52 0.41
53 0.39
54 0.31
55 0.28
56 0.24
57 0.18
58 0.11
59 0.09
60 0.08
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.09
71 0.1
72 0.14
73 0.14
74 0.14
75 0.14
76 0.14
77 0.24
78 0.26
79 0.26
80 0.22
81 0.23
82 0.24
83 0.24
84 0.25
85 0.15
86 0.13
87 0.12
88 0.13
89 0.12
90 0.12
91 0.14
92 0.22
93 0.27
94 0.32
95 0.38
96 0.41
97 0.47
98 0.56
99 0.6
100 0.61
101 0.57
102 0.57
103 0.58
104 0.54
105 0.48
106 0.37
107 0.34
108 0.28
109 0.28
110 0.24
111 0.16
112 0.17
113 0.24
114 0.27
115 0.27
116 0.3
117 0.35
118 0.36
119 0.39
120 0.4
121 0.35
122 0.32
123 0.31
124 0.29
125 0.23
126 0.2
127 0.2
128 0.22
129 0.25
130 0.28
131 0.25
132 0.28
133 0.33
134 0.39
135 0.45
136 0.51
137 0.57
138 0.65
139 0.72
140 0.78
141 0.75
142 0.72
143 0.67
144 0.65
145 0.64
146 0.63