Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7YE17

Protein Details
Accession A0A2B7YE17   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-43SPLQQAQSNLRQKQRRRRKNLCQKIVELTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 13.166, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MHTGTPTRSQRNKQSPLQQAQSNLRQKQRRRRKNLCQKIVELTSRKHAQVYISIELDDQYFILNTDSSGTWPPPEEQIERHYPNTVRKTPGDYRALTSTKLRRETIFKKSVEYSDICGANVHTIIYINNRYFTLYTNGKPPPSAEQLVWSSEPKLHALADEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.78
5 0.7
6 0.66
7 0.66
8 0.67
9 0.66
10 0.63
11 0.63
12 0.66
13 0.72
14 0.77
15 0.8
16 0.81
17 0.83
18 0.87
19 0.9
20 0.93
21 0.94
22 0.93
23 0.88
24 0.8
25 0.76
26 0.71
27 0.66
28 0.58
29 0.49
30 0.47
31 0.44
32 0.41
33 0.35
34 0.31
35 0.26
36 0.28
37 0.31
38 0.26
39 0.23
40 0.23
41 0.22
42 0.21
43 0.2
44 0.13
45 0.08
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.09
56 0.08
57 0.08
58 0.1
59 0.1
60 0.11
61 0.14
62 0.14
63 0.14
64 0.19
65 0.25
66 0.26
67 0.26
68 0.27
69 0.27
70 0.33
71 0.38
72 0.37
73 0.33
74 0.32
75 0.38
76 0.4
77 0.44
78 0.41
79 0.35
80 0.34
81 0.37
82 0.37
83 0.31
84 0.33
85 0.32
86 0.34
87 0.37
88 0.36
89 0.32
90 0.39
91 0.44
92 0.48
93 0.49
94 0.43
95 0.43
96 0.44
97 0.43
98 0.39
99 0.34
100 0.28
101 0.26
102 0.26
103 0.22
104 0.2
105 0.19
106 0.17
107 0.16
108 0.12
109 0.07
110 0.07
111 0.08
112 0.12
113 0.17
114 0.16
115 0.18
116 0.18
117 0.19
118 0.19
119 0.21
120 0.23
121 0.23
122 0.24
123 0.3
124 0.34
125 0.33
126 0.33
127 0.33
128 0.33
129 0.34
130 0.36
131 0.29
132 0.31
133 0.32
134 0.35
135 0.35
136 0.3
137 0.25
138 0.25
139 0.26
140 0.22
141 0.21
142 0.18