Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7YKI2

Protein Details
Accession A0A2B7YKI2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-37SFTQTKCKSCRAKLTKSPGRTHydrophilic
NLS Segment(s)
PositionSequence
42-46RRTRK
Subcellular Location(s) nucl 6.5, cyto_nucl 6.5, mito 6, plas 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MDELELAYCIGSTYQASFTQTKCKSCRAKLTKSPGRTVSPARRTRKNSPGSMGLSRKLYASIRFPRWAHQRRAARKIEYKGYRIPEGATTVINQWAMDHDENVYGDLFMVIIILYIYMVTYPGSLLQLLLNTAWLFWAYDVRHPVGELGRTFELNLDEMMKPHNGGSAFNQVPHFDTSITVRGSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.17
4 0.2
5 0.22
6 0.31
7 0.35
8 0.4
9 0.41
10 0.49
11 0.54
12 0.58
13 0.68
14 0.67
15 0.72
16 0.74
17 0.81
18 0.81
19 0.77
20 0.77
21 0.71
22 0.67
23 0.62
24 0.61
25 0.6
26 0.62
27 0.66
28 0.66
29 0.7
30 0.72
31 0.77
32 0.77
33 0.75
34 0.69
35 0.65
36 0.64
37 0.6
38 0.59
39 0.53
40 0.46
41 0.4
42 0.36
43 0.31
44 0.27
45 0.24
46 0.2
47 0.25
48 0.3
49 0.33
50 0.38
51 0.38
52 0.43
53 0.52
54 0.58
55 0.56
56 0.57
57 0.62
58 0.64
59 0.73
60 0.7
61 0.66
62 0.65
63 0.63
64 0.63
65 0.58
66 0.53
67 0.5
68 0.47
69 0.43
70 0.36
71 0.32
72 0.24
73 0.22
74 0.19
75 0.14
76 0.11
77 0.1
78 0.11
79 0.1
80 0.09
81 0.07
82 0.07
83 0.1
84 0.09
85 0.09
86 0.08
87 0.09
88 0.09
89 0.09
90 0.08
91 0.05
92 0.05
93 0.05
94 0.04
95 0.03
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.05
122 0.05
123 0.05
124 0.1
125 0.1
126 0.15
127 0.18
128 0.19
129 0.19
130 0.19
131 0.21
132 0.18
133 0.21
134 0.18
135 0.2
136 0.2
137 0.2
138 0.2
139 0.19
140 0.18
141 0.14
142 0.15
143 0.13
144 0.12
145 0.13
146 0.15
147 0.14
148 0.13
149 0.13
150 0.16
151 0.13
152 0.15
153 0.19
154 0.26
155 0.26
156 0.28
157 0.3
158 0.27
159 0.29
160 0.29
161 0.26
162 0.17
163 0.18
164 0.19
165 0.23
166 0.23