Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Z4H2

Protein Details
Accession A0A2B7Z4H2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-120YPLPLFKRLHAKGKKPRFMLRKNNHydrophilic
NLS Segment(s)
PositionSequence
104-118RLHAKGKKPRFMLRK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000159  RA_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00788  RA  
PROSITE View protein in PROSITE  
PS50200  RA  
Amino Acid Sequences MEENPVLAEDHGEVMEAPSPYETSDSPPLADDDLPTATNDLSQKLRVKKHEPTWKLLELTMKRYKLNGKWEDYALYIVYSEGKEEEPLQRRLELSEYPLPLFKRLHAKGKKPRFMLRKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.1
4 0.1
5 0.1
6 0.1
7 0.1
8 0.12
9 0.12
10 0.14
11 0.19
12 0.2
13 0.19
14 0.2
15 0.2
16 0.2
17 0.19
18 0.14
19 0.11
20 0.12
21 0.12
22 0.11
23 0.11
24 0.09
25 0.11
26 0.11
27 0.12
28 0.12
29 0.15
30 0.22
31 0.27
32 0.33
33 0.37
34 0.42
35 0.47
36 0.55
37 0.61
38 0.58
39 0.58
40 0.58
41 0.54
42 0.49
43 0.43
44 0.4
45 0.32
46 0.36
47 0.36
48 0.32
49 0.29
50 0.3
51 0.34
52 0.32
53 0.4
54 0.39
55 0.38
56 0.38
57 0.39
58 0.38
59 0.33
60 0.29
61 0.2
62 0.14
63 0.09
64 0.07
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.17
73 0.22
74 0.25
75 0.26
76 0.27
77 0.27
78 0.28
79 0.29
80 0.23
81 0.24
82 0.26
83 0.26
84 0.26
85 0.29
86 0.29
87 0.29
88 0.29
89 0.27
90 0.32
91 0.35
92 0.45
93 0.5
94 0.59
95 0.66
96 0.76
97 0.81
98 0.77
99 0.82
100 0.82