Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PEB4

Protein Details
Accession J3PEB4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-110QDGSSPRRAGRPKRLARRIMRNHydrophilic
NLS Segment(s)
PositionSequence
94-110PRRAGRPKRLARRIMRN
Subcellular Location(s) extr 19, mito 4, cyto 2, plas 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MRPAFFLAVLSSALVAAQWKLVCSPVPTDSCRPFCQCVGGMRDCPVSPPPQCQQYCRCDVDNSNPPPPYTGGRNGGGKPSPHNLPTPPQDGSSPRRAGRPKRLARRIMRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.08
5 0.08
6 0.08
7 0.09
8 0.1
9 0.12
10 0.13
11 0.16
12 0.18
13 0.21
14 0.25
15 0.31
16 0.36
17 0.39
18 0.41
19 0.42
20 0.4
21 0.36
22 0.36
23 0.33
24 0.31
25 0.32
26 0.31
27 0.28
28 0.27
29 0.28
30 0.24
31 0.23
32 0.2
33 0.19
34 0.17
35 0.21
36 0.22
37 0.3
38 0.31
39 0.33
40 0.37
41 0.38
42 0.42
43 0.4
44 0.38
45 0.32
46 0.33
47 0.37
48 0.4
49 0.38
50 0.38
51 0.36
52 0.34
53 0.34
54 0.34
55 0.29
56 0.24
57 0.25
58 0.24
59 0.26
60 0.3
61 0.29
62 0.32
63 0.32
64 0.29
65 0.28
66 0.28
67 0.29
68 0.27
69 0.29
70 0.27
71 0.31
72 0.36
73 0.36
74 0.33
75 0.31
76 0.33
77 0.36
78 0.39
79 0.41
80 0.42
81 0.4
82 0.47
83 0.54
84 0.6
85 0.66
86 0.71
87 0.72
88 0.77
89 0.85
90 0.87