Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Y929

Protein Details
Accession A0A2B7Y929    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-72CLGAERYKRAQRNREKARENRKRIEEVHydrophilic
NLS Segment(s)
PositionSequence
53-68KRAQRNREKARENRKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHSHLHTKDNINCEEIMNMLDECHARGFLHKALAGCNDIKRDVNRCLGAERYKRAQRNREKARENRKRIEEVWRKEDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.23
3 0.18
4 0.13
5 0.11
6 0.08
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.07
13 0.09
14 0.13
15 0.13
16 0.15
17 0.16
18 0.16
19 0.16
20 0.18
21 0.18
22 0.16
23 0.16
24 0.15
25 0.14
26 0.16
27 0.16
28 0.19
29 0.2
30 0.23
31 0.23
32 0.23
33 0.23
34 0.26
35 0.32
36 0.33
37 0.34
38 0.38
39 0.43
40 0.5
41 0.57
42 0.62
43 0.66
44 0.72
45 0.78
46 0.8
47 0.82
48 0.85
49 0.88
50 0.89
51 0.87
52 0.86
53 0.82
54 0.78
55 0.72
56 0.73
57 0.72
58 0.7
59 0.68