Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NJ96

Protein Details
Accession J3NJ96    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
142-161GAGRINSHPSRPRRKPSTVRHydrophilic
NLS Segment(s)
PositionSequence
152-156RPRRK
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRRGEADGRKSAGAFRRTSPNCAAGNVGAHALVGARAATHTTPATSSGSCFGASKIRGVEEAQQHGSGRWLGEASKASVLGSKPEAVWRVEGGTGCVVWCGAVRGACVDAGGQKTEAQGDKQLVPRSVTRPSTKDAAEQINGAGRINSHPSRPRRKPSTVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.43
4 0.45
5 0.5
6 0.48
7 0.47
8 0.42
9 0.4
10 0.38
11 0.29
12 0.28
13 0.23
14 0.19
15 0.12
16 0.11
17 0.09
18 0.07
19 0.06
20 0.05
21 0.04
22 0.03
23 0.04
24 0.06
25 0.06
26 0.08
27 0.08
28 0.08
29 0.09
30 0.11
31 0.13
32 0.12
33 0.13
34 0.13
35 0.13
36 0.13
37 0.13
38 0.12
39 0.15
40 0.15
41 0.17
42 0.15
43 0.15
44 0.15
45 0.16
46 0.21
47 0.19
48 0.22
49 0.21
50 0.22
51 0.21
52 0.2
53 0.21
54 0.15
55 0.11
56 0.08
57 0.07
58 0.07
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.1
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.11
72 0.13
73 0.11
74 0.12
75 0.1
76 0.1
77 0.11
78 0.11
79 0.1
80 0.08
81 0.08
82 0.07
83 0.07
84 0.05
85 0.04
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.08
93 0.07
94 0.07
95 0.06
96 0.08
97 0.09
98 0.1
99 0.09
100 0.1
101 0.1
102 0.13
103 0.14
104 0.12
105 0.15
106 0.17
107 0.2
108 0.25
109 0.29
110 0.29
111 0.3
112 0.33
113 0.33
114 0.38
115 0.4
116 0.4
117 0.38
118 0.4
119 0.43
120 0.4
121 0.4
122 0.38
123 0.38
124 0.33
125 0.31
126 0.28
127 0.28
128 0.27
129 0.23
130 0.18
131 0.14
132 0.16
133 0.23
134 0.24
135 0.27
136 0.35
137 0.45
138 0.56
139 0.64
140 0.72
141 0.73