Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7YBI3

Protein Details
Accession A0A2B7YBI3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-81MPSQKSFRTKQKLAKAQKQNRPIPQWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MTHSLTLNPIGKRAAHSPKSTQNFPRTCRSHGQHSDFINSHPFTSRAFAVFKTATMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTNNTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.42
4 0.46
5 0.54
6 0.59
7 0.62
8 0.61
9 0.6
10 0.61
11 0.61
12 0.65
13 0.59
14 0.57
15 0.6
16 0.56
17 0.57
18 0.58
19 0.61
20 0.57
21 0.54
22 0.55
23 0.46
24 0.43
25 0.38
26 0.3
27 0.24
28 0.2
29 0.19
30 0.14
31 0.16
32 0.15
33 0.11
34 0.12
35 0.11
36 0.14
37 0.13
38 0.13
39 0.13
40 0.13
41 0.13
42 0.16
43 0.17
44 0.16
45 0.21
46 0.23
47 0.27
48 0.34
49 0.42
50 0.48
51 0.53
52 0.6
53 0.66
54 0.73
55 0.77
56 0.8
57 0.81
58 0.82
59 0.84
60 0.85
61 0.83
62 0.82
63 0.79
64 0.78
65 0.74
66 0.73
67 0.74
68 0.71
69 0.71
70 0.7
71 0.7