Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7WEV2

Protein Details
Accession A0A2B7WEV2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-68TDSPRGRRRAVKRTRRRRRHPQASKGRGSIBasic
NLS Segment(s)
PositionSequence
43-74RGRRRAVKRTRRRRRHPQASKGRGSIPRTARR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MIEKQKAKKRETETGETGTGTAETAESAETAESETEAETDSPRGRRRAVKRTRRRRRHPQASKGRGSIPRTARRQLPVINRSKLETALRKLSDERTRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.58
3 0.49
4 0.42
5 0.32
6 0.24
7 0.16
8 0.11
9 0.06
10 0.05
11 0.05
12 0.05
13 0.04
14 0.05
15 0.04
16 0.04
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.08
27 0.1
28 0.15
29 0.18
30 0.21
31 0.23
32 0.32
33 0.39
34 0.48
35 0.56
36 0.63
37 0.7
38 0.79
39 0.87
40 0.9
41 0.92
42 0.92
43 0.93
44 0.93
45 0.93
46 0.92
47 0.92
48 0.9
49 0.86
50 0.77
51 0.71
52 0.66
53 0.59
54 0.57
55 0.54
56 0.54
57 0.55
58 0.56
59 0.55
60 0.52
61 0.54
62 0.53
63 0.54
64 0.54
65 0.58
66 0.58
67 0.55
68 0.54
69 0.51
70 0.47
71 0.45
72 0.44
73 0.41
74 0.45
75 0.45
76 0.45
77 0.46
78 0.52