Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Y6S2

Protein Details
Accession A0A2B7Y6S2   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPRNLNKVQKQISKKRGKVDALHydrophilic
NLS Segment(s)
PositionSequence
102-106RPGRP
Subcellular Location(s) nucl 17.5, mito_nucl 12, mito 5.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MPRNLNKVQKQISKKRGKVDALHENSRDSKRLRRAGVREDKLTRAAAVTMRGRQIFIDRVQFFQENIADPPVRFSDEDVVQLITRFIARNQPELDELHKERRPGRPPVKREEVLREKMDAENKEFESGFWLPDMTDEENLRKLAAWNGEWSSMSTLRFVRVSRGAGKKESSFPPRGLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.8
4 0.78
5 0.74
6 0.73
7 0.73
8 0.69
9 0.7
10 0.62
11 0.57
12 0.57
13 0.53
14 0.49
15 0.42
16 0.44
17 0.47
18 0.54
19 0.57
20 0.59
21 0.63
22 0.69
23 0.76
24 0.72
25 0.69
26 0.64
27 0.6
28 0.54
29 0.48
30 0.37
31 0.27
32 0.23
33 0.18
34 0.19
35 0.2
36 0.2
37 0.23
38 0.23
39 0.22
40 0.21
41 0.23
42 0.22
43 0.21
44 0.27
45 0.24
46 0.25
47 0.28
48 0.28
49 0.25
50 0.23
51 0.22
52 0.15
53 0.15
54 0.16
55 0.14
56 0.13
57 0.15
58 0.13
59 0.14
60 0.12
61 0.12
62 0.14
63 0.14
64 0.15
65 0.14
66 0.13
67 0.12
68 0.12
69 0.11
70 0.07
71 0.07
72 0.06
73 0.06
74 0.12
75 0.13
76 0.17
77 0.17
78 0.18
79 0.19
80 0.2
81 0.21
82 0.2
83 0.21
84 0.25
85 0.26
86 0.27
87 0.3
88 0.37
89 0.41
90 0.45
91 0.53
92 0.56
93 0.59
94 0.65
95 0.69
96 0.64
97 0.61
98 0.61
99 0.59
100 0.55
101 0.52
102 0.45
103 0.38
104 0.39
105 0.41
106 0.33
107 0.29
108 0.27
109 0.27
110 0.27
111 0.26
112 0.22
113 0.22
114 0.2
115 0.17
116 0.13
117 0.12
118 0.1
119 0.11
120 0.15
121 0.11
122 0.14
123 0.15
124 0.17
125 0.19
126 0.19
127 0.19
128 0.16
129 0.15
130 0.17
131 0.2
132 0.19
133 0.2
134 0.22
135 0.23
136 0.23
137 0.23
138 0.23
139 0.21
140 0.2
141 0.19
142 0.19
143 0.2
144 0.23
145 0.22
146 0.23
147 0.26
148 0.3
149 0.36
150 0.43
151 0.44
152 0.46
153 0.5
154 0.48
155 0.5
156 0.55
157 0.54
158 0.5