Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7X396

Protein Details
Accession A0A2B7X396    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-61YGSLRHHLRRPTHPFRKSHRSKPRRWPLVLRFIKGBasic
NLS Segment(s)
PositionSequence
34-52LRRPTHPFRKSHRSKPRRW
Subcellular Location(s) plas 22, nucl 1, mito 1, cyto 1, cyto_nucl 1, E.R. 1, golg 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021134  Bestrophin-like  
IPR044669  YneE/VCCN1/2-like  
Gene Ontology GO:0016020  C:membrane  
GO:0005254  F:chloride channel activity  
Pfam View protein in Pfam  
PF01062  Bestrophin  
Amino Acid Sequences MHFTETSSSQNPVTNGSDSAGLTRSGYGSLRHHLRRPTHPFRKSHRSKPRRWPLVLRFIKGAVHISILIPVICHALFTALIVSLDKYVYDSLGLPPTIIPSLSIVVGLILVFRNQTSYNRFWDGRNNLAAINASIRNLTRSILTHAYNPDGTPLTAAEKHDVERTIRVLMAIPYAVKNYLRAEWGAAWQLDYNSGDSNYDGSGGGGSASLSHAVESSNLLRHTESNRNNAIDGDEEDRPFNPEYSPLLPPGLHSHESEGLGLPLQLTFFVDSFLKRGLNRDWFPPPVTATLQAQLNALTDAYGRMETIKLTPIPVAHLIHQKQVLALFGAVLPFAMVDDMGWWAVPIVSLVLFTLYGIEGIGSQLEDPFGYDRNDIRMDAIVEDARVEIEAVLREWRRVLVEGEREREVRSVGAGSAGEYEPKEMFIRMRARTGERRRSGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.24
5 0.21
6 0.22
7 0.19
8 0.16
9 0.15
10 0.15
11 0.14
12 0.14
13 0.15
14 0.17
15 0.2
16 0.27
17 0.36
18 0.41
19 0.46
20 0.52
21 0.58
22 0.65
23 0.71
24 0.74
25 0.76
26 0.78
27 0.81
28 0.82
29 0.86
30 0.85
31 0.86
32 0.86
33 0.86
34 0.88
35 0.9
36 0.92
37 0.91
38 0.88
39 0.88
40 0.85
41 0.86
42 0.82
43 0.74
44 0.65
45 0.56
46 0.51
47 0.42
48 0.35
49 0.25
50 0.19
51 0.17
52 0.15
53 0.15
54 0.15
55 0.13
56 0.1
57 0.09
58 0.1
59 0.09
60 0.09
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.08
72 0.07
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.11
79 0.14
80 0.14
81 0.13
82 0.13
83 0.15
84 0.14
85 0.13
86 0.11
87 0.08
88 0.09
89 0.09
90 0.09
91 0.07
92 0.06
93 0.06
94 0.06
95 0.05
96 0.04
97 0.05
98 0.05
99 0.05
100 0.07
101 0.08
102 0.13
103 0.18
104 0.21
105 0.26
106 0.31
107 0.33
108 0.32
109 0.4
110 0.41
111 0.4
112 0.39
113 0.35
114 0.29
115 0.29
116 0.28
117 0.19
118 0.18
119 0.13
120 0.11
121 0.11
122 0.11
123 0.12
124 0.12
125 0.12
126 0.11
127 0.12
128 0.16
129 0.19
130 0.2
131 0.22
132 0.23
133 0.25
134 0.23
135 0.22
136 0.19
137 0.16
138 0.15
139 0.12
140 0.11
141 0.12
142 0.14
143 0.15
144 0.15
145 0.15
146 0.16
147 0.18
148 0.19
149 0.17
150 0.17
151 0.18
152 0.16
153 0.15
154 0.14
155 0.13
156 0.12
157 0.11
158 0.09
159 0.08
160 0.08
161 0.08
162 0.09
163 0.08
164 0.09
165 0.1
166 0.12
167 0.12
168 0.12
169 0.12
170 0.12
171 0.13
172 0.14
173 0.12
174 0.11
175 0.11
176 0.11
177 0.11
178 0.1
179 0.1
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.07
186 0.07
187 0.06
188 0.05
189 0.05
190 0.05
191 0.05
192 0.04
193 0.04
194 0.03
195 0.03
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.06
203 0.07
204 0.09
205 0.1
206 0.1
207 0.1
208 0.12
209 0.17
210 0.25
211 0.27
212 0.3
213 0.32
214 0.32
215 0.32
216 0.3
217 0.26
218 0.18
219 0.16
220 0.14
221 0.12
222 0.12
223 0.13
224 0.12
225 0.14
226 0.14
227 0.13
228 0.1
229 0.11
230 0.13
231 0.16
232 0.17
233 0.15
234 0.15
235 0.15
236 0.15
237 0.18
238 0.19
239 0.18
240 0.17
241 0.18
242 0.2
243 0.2
244 0.2
245 0.16
246 0.11
247 0.1
248 0.09
249 0.07
250 0.05
251 0.04
252 0.04
253 0.04
254 0.05
255 0.05
256 0.06
257 0.07
258 0.07
259 0.08
260 0.1
261 0.11
262 0.11
263 0.15
264 0.19
265 0.27
266 0.28
267 0.31
268 0.34
269 0.34
270 0.36
271 0.34
272 0.3
273 0.25
274 0.24
275 0.22
276 0.19
277 0.19
278 0.19
279 0.18
280 0.16
281 0.14
282 0.13
283 0.11
284 0.09
285 0.07
286 0.06
287 0.06
288 0.06
289 0.06
290 0.06
291 0.06
292 0.07
293 0.07
294 0.08
295 0.12
296 0.11
297 0.12
298 0.13
299 0.13
300 0.15
301 0.18
302 0.18
303 0.18
304 0.26
305 0.27
306 0.29
307 0.3
308 0.28
309 0.25
310 0.24
311 0.21
312 0.13
313 0.12
314 0.08
315 0.08
316 0.08
317 0.06
318 0.05
319 0.05
320 0.04
321 0.04
322 0.03
323 0.03
324 0.02
325 0.03
326 0.04
327 0.04
328 0.04
329 0.04
330 0.04
331 0.04
332 0.05
333 0.04
334 0.04
335 0.04
336 0.04
337 0.04
338 0.05
339 0.05
340 0.05
341 0.05
342 0.05
343 0.05
344 0.04
345 0.05
346 0.04
347 0.05
348 0.05
349 0.04
350 0.04
351 0.05
352 0.05
353 0.05
354 0.06
355 0.08
356 0.1
357 0.12
358 0.14
359 0.15
360 0.2
361 0.22
362 0.21
363 0.21
364 0.21
365 0.21
366 0.19
367 0.2
368 0.15
369 0.14
370 0.14
371 0.12
372 0.1
373 0.09
374 0.08
375 0.06
376 0.07
377 0.09
378 0.09
379 0.16
380 0.17
381 0.18
382 0.18
383 0.2
384 0.2
385 0.21
386 0.24
387 0.25
388 0.34
389 0.39
390 0.43
391 0.45
392 0.43
393 0.43
394 0.41
395 0.34
396 0.25
397 0.2
398 0.18
399 0.14
400 0.16
401 0.14
402 0.13
403 0.16
404 0.15
405 0.16
406 0.14
407 0.17
408 0.14
409 0.16
410 0.17
411 0.15
412 0.17
413 0.23
414 0.31
415 0.32
416 0.38
417 0.41
418 0.48
419 0.56
420 0.65
421 0.68