Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7WUG7

Protein Details
Accession A0A2B7WUG7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-28LSSLLKVKARRQKREEFNITKQSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MQSVLSSLLKVKARRQKREEFNITKQSTIWVQWKFLLLLYKRVAGKNMNEVIEEQVSEFILGPFSPGQNLDTSLPYANPLVQTSFASPSFRSGHQVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.71
4 0.76
5 0.83
6 0.85
7 0.83
8 0.81
9 0.81
10 0.75
11 0.65
12 0.55
13 0.46
14 0.38
15 0.33
16 0.31
17 0.22
18 0.23
19 0.23
20 0.24
21 0.22
22 0.22
23 0.25
24 0.19
25 0.23
26 0.23
27 0.26
28 0.26
29 0.27
30 0.27
31 0.23
32 0.23
33 0.24
34 0.26
35 0.22
36 0.21
37 0.21
38 0.2
39 0.18
40 0.16
41 0.09
42 0.07
43 0.06
44 0.06
45 0.06
46 0.04
47 0.05
48 0.04
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.08
55 0.09
56 0.11
57 0.11
58 0.12
59 0.13
60 0.13
61 0.13
62 0.13
63 0.13
64 0.12
65 0.12
66 0.12
67 0.12
68 0.13
69 0.14
70 0.15
71 0.19
72 0.19
73 0.2
74 0.2
75 0.23
76 0.25
77 0.25