Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7X8B2

Protein Details
Accession A0A2B7X8B2   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-31SVPTSHDPRSKRPLKRRALTPVSEHydrophilic
118-147EEARRRDEEKTEKNRRKREKKKAAAAAAKKBasic
NLS Segment(s)
PositionSequence
115-153KRREEARRRDEEKTEKNRRKREKKKAAAAAAKKGGKKGA
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESVPTSHDPRSKRPLKRRALTPVSEQATQIDSLFKDPSKPLNLPPSSKPRTSTSLAPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMEEELKMEKEDEGFEKRREEARRRDEEKTEKNRRKREKKKAAAAAAKKGGKKGAADVEMRDGEKKGGDSEDKGNGEVGGDGEKVAGVEGITDGDAETPGVIIHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.54
4 0.59
5 0.66
6 0.72
7 0.76
8 0.81
9 0.85
10 0.85
11 0.85
12 0.84
13 0.77
14 0.73
15 0.72
16 0.65
17 0.57
18 0.49
19 0.39
20 0.33
21 0.29
22 0.23
23 0.16
24 0.13
25 0.14
26 0.17
27 0.15
28 0.17
29 0.18
30 0.24
31 0.27
32 0.28
33 0.31
34 0.39
35 0.42
36 0.43
37 0.48
38 0.52
39 0.51
40 0.51
41 0.5
42 0.44
43 0.46
44 0.45
45 0.45
46 0.43
47 0.47
48 0.46
49 0.44
50 0.39
51 0.35
52 0.32
53 0.26
54 0.18
55 0.11
56 0.11
57 0.1
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.07
72 0.07
73 0.12
74 0.19
75 0.27
76 0.31
77 0.35
78 0.41
79 0.5
80 0.57
81 0.62
82 0.62
83 0.57
84 0.53
85 0.5
86 0.46
87 0.4
88 0.33
89 0.26
90 0.18
91 0.16
92 0.14
93 0.14
94 0.12
95 0.09
96 0.09
97 0.09
98 0.14
99 0.17
100 0.18
101 0.2
102 0.21
103 0.27
104 0.33
105 0.38
106 0.43
107 0.49
108 0.57
109 0.61
110 0.63
111 0.64
112 0.67
113 0.69
114 0.7
115 0.72
116 0.71
117 0.76
118 0.82
119 0.85
120 0.88
121 0.89
122 0.89
123 0.89
124 0.9
125 0.91
126 0.9
127 0.88
128 0.85
129 0.79
130 0.75
131 0.71
132 0.65
133 0.56
134 0.49
135 0.42
136 0.35
137 0.31
138 0.29
139 0.28
140 0.28
141 0.28
142 0.27
143 0.3
144 0.29
145 0.29
146 0.26
147 0.2
148 0.17
149 0.17
150 0.17
151 0.14
152 0.16
153 0.17
154 0.19
155 0.23
156 0.29
157 0.29
158 0.28
159 0.27
160 0.23
161 0.21
162 0.18
163 0.14
164 0.09
165 0.08
166 0.08
167 0.07
168 0.07
169 0.07
170 0.06
171 0.06
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.06
180 0.06
181 0.06
182 0.05
183 0.05
184 0.05
185 0.05