Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Y3Q1

Protein Details
Accession A0A2B7Y3Q1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-26SVGAATKTRRHPHPKPARHVLFNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto_mito 12, cyto 6, extr 5
Family & Domain DBs
Amino Acid Sequences MTLSVGAATKTRRHPHPKPARHVLFNGLCVDISSIEYEPWLSPLTASGTAIPTFSVPEMTLGLHLLWRVRNSTLVENWNGAQGAQVPNHLPYLDSWDSWNTPVSCALSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.77
4 0.81
5 0.81
6 0.85
7 0.82
8 0.76
9 0.71
10 0.68
11 0.59
12 0.51
13 0.43
14 0.33
15 0.26
16 0.22
17 0.2
18 0.12
19 0.1
20 0.09
21 0.08
22 0.07
23 0.07
24 0.08
25 0.07
26 0.08
27 0.08
28 0.07
29 0.06
30 0.07
31 0.1
32 0.1
33 0.1
34 0.09
35 0.1
36 0.1
37 0.1
38 0.09
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.06
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.09
55 0.1
56 0.11
57 0.14
58 0.16
59 0.2
60 0.22
61 0.24
62 0.24
63 0.24
64 0.23
65 0.22
66 0.19
67 0.15
68 0.12
69 0.12
70 0.14
71 0.13
72 0.15
73 0.14
74 0.15
75 0.16
76 0.16
77 0.13
78 0.1
79 0.19
80 0.19
81 0.18
82 0.19
83 0.22
84 0.23
85 0.24
86 0.3
87 0.22
88 0.22
89 0.24