Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XYF1

Protein Details
Accession A0A2B7XYF1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
94-114DGAPKGKKRAQQTRKGAWRDVHydrophilic
NLS Segment(s)
PositionSequence
99-102GKKR
Subcellular Location(s) plas 11, mito 6, extr 5, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008504  Emc6  
IPR029008  EMC6-like  
Gene Ontology GO:0072546  C:EMC complex  
GO:0006996  P:organelle organization  
Pfam View protein in Pfam  
PF07019  EMC6  
Amino Acid Sequences MPPTPQELSLLINPLVPDSVMHNNRTLSTLHSLTAFLLGLCAGILGLRSSYGFIFYLLGTLFVSFLFHAVLVGFSNGVGAFFPGSGELATEGGDGAPKGKKRAQQTRKGAWRDVWFGGGVMGEALSGFVLGWAGVGGVLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.13
4 0.11
5 0.12
6 0.21
7 0.23
8 0.25
9 0.27
10 0.27
11 0.28
12 0.29
13 0.25
14 0.19
15 0.21
16 0.21
17 0.19
18 0.18
19 0.18
20 0.17
21 0.17
22 0.13
23 0.07
24 0.07
25 0.06
26 0.05
27 0.04
28 0.04
29 0.03
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.06
47 0.05
48 0.05
49 0.04
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.03
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.03
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.04
82 0.06
83 0.1
84 0.11
85 0.16
86 0.2
87 0.25
88 0.35
89 0.46
90 0.54
91 0.61
92 0.69
93 0.75
94 0.81
95 0.8
96 0.74
97 0.69
98 0.65
99 0.59
100 0.5
101 0.41
102 0.32
103 0.27
104 0.24
105 0.17
106 0.12
107 0.07
108 0.06
109 0.04
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03