Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7W7R5

Protein Details
Accession A0A2B7W7R5   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-39KIPWRLSAPQKARQRKRLRAVDKVVHydrophilic
74-93KYTIFDRKEKKYRKGIHSMLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPVLGGLLWKIPWRLSAPQKARQRKRLRAVDKVVDTVSSALERQGMTSKAVTRWYEEMPREEEMLPKDKYTIFDRKEKKYRKGIHSMLLSFFHLCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.15
4 0.16
5 0.19
6 0.26
7 0.32
8 0.42
9 0.46
10 0.54
11 0.64
12 0.72
13 0.77
14 0.79
15 0.81
16 0.81
17 0.85
18 0.86
19 0.83
20 0.81
21 0.79
22 0.76
23 0.67
24 0.59
25 0.49
26 0.38
27 0.32
28 0.23
29 0.16
30 0.09
31 0.08
32 0.06
33 0.07
34 0.07
35 0.07
36 0.09
37 0.1
38 0.1
39 0.11
40 0.13
41 0.13
42 0.17
43 0.17
44 0.17
45 0.19
46 0.21
47 0.25
48 0.25
49 0.26
50 0.25
51 0.26
52 0.26
53 0.23
54 0.24
55 0.22
56 0.26
57 0.24
58 0.21
59 0.22
60 0.21
61 0.24
62 0.27
63 0.33
64 0.31
65 0.4
66 0.47
67 0.55
68 0.64
69 0.7
70 0.73
71 0.74
72 0.8
73 0.79
74 0.82
75 0.77
76 0.75
77 0.74
78 0.67
79 0.6
80 0.52
81 0.46