Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PBW0

Protein Details
Accession J3PBW0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPAFCKNTYGRRTKNNTNKSTNWHydrophilic
NLS Segment(s)
PositionSequence
42-54KGKRAGPRPTRSP
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
Amino Acid Sequences MPAFCKNTYGRRTKNNTNKSTNWNAIKALICRILGTSQALAKGKRAGPRPTRSPKEKTIIILCPHSNYPNGLLPKAEAWQIRYKLLYIPTRYDKDVKSLYKFPSNLNNPKYVKLFAIKTLAITISLNKQHFHIRVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.82
4 0.8
5 0.79
6 0.77
7 0.77
8 0.74
9 0.68
10 0.59
11 0.52
12 0.48
13 0.45
14 0.39
15 0.34
16 0.29
17 0.24
18 0.22
19 0.22
20 0.19
21 0.16
22 0.16
23 0.14
24 0.12
25 0.16
26 0.18
27 0.17
28 0.18
29 0.22
30 0.24
31 0.29
32 0.34
33 0.39
34 0.46
35 0.53
36 0.6
37 0.65
38 0.69
39 0.7
40 0.7
41 0.67
42 0.64
43 0.59
44 0.52
45 0.47
46 0.44
47 0.4
48 0.37
49 0.31
50 0.27
51 0.26
52 0.24
53 0.2
54 0.15
55 0.15
56 0.16
57 0.17
58 0.16
59 0.15
60 0.14
61 0.14
62 0.15
63 0.15
64 0.11
65 0.13
66 0.2
67 0.21
68 0.22
69 0.22
70 0.21
71 0.21
72 0.27
73 0.29
74 0.25
75 0.29
76 0.34
77 0.37
78 0.38
79 0.4
80 0.34
81 0.35
82 0.39
83 0.38
84 0.37
85 0.41
86 0.42
87 0.46
88 0.46
89 0.43
90 0.46
91 0.51
92 0.54
93 0.51
94 0.56
95 0.5
96 0.53
97 0.53
98 0.45
99 0.39
100 0.36
101 0.35
102 0.3
103 0.33
104 0.29
105 0.27
106 0.27
107 0.24
108 0.19
109 0.18
110 0.17
111 0.19
112 0.26
113 0.27
114 0.26
115 0.28
116 0.35