Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Y098

Protein Details
Accession A0A2B7Y098   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-124KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MVQFRSLLSSSSPLLSLRQYTHPSSFPRQICRAVFSRSLWSASRPSSITRMLPWTGLFRKLGNVSGSALRTVGDKTGLVPGQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.19
5 0.24
6 0.28
7 0.31
8 0.34
9 0.37
10 0.4
11 0.44
12 0.49
13 0.47
14 0.5
15 0.5
16 0.52
17 0.49
18 0.48
19 0.44
20 0.4
21 0.39
22 0.34
23 0.35
24 0.3
25 0.32
26 0.28
27 0.27
28 0.26
29 0.24
30 0.25
31 0.21
32 0.21
33 0.22
34 0.23
35 0.21
36 0.19
37 0.22
38 0.19
39 0.19
40 0.18
41 0.2
42 0.19
43 0.2
44 0.19
45 0.16
46 0.18
47 0.18
48 0.19
49 0.15
50 0.14
51 0.13
52 0.14
53 0.14
54 0.12
55 0.11
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.06
62 0.07
63 0.11
64 0.11
65 0.11
66 0.11
67 0.11
68 0.17
69 0.18
70 0.18
71 0.17
72 0.19
73 0.2
74 0.23
75 0.32
76 0.32
77 0.38
78 0.42
79 0.43
80 0.5
81 0.52
82 0.53
83 0.52
84 0.53
85 0.55
86 0.61
87 0.65
88 0.67
89 0.74
90 0.79
91 0.78
92 0.8
93 0.81
94 0.79
95 0.78
96 0.79
97 0.77
98 0.77
99 0.79
100 0.75
101 0.75
102 0.78
103 0.81
104 0.82