Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XS33

Protein Details
Accession A0A2B7XS33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-80TSTTTTPRTTRRHGLRRTRVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 7, mito 5, vacu 5
Family & Domain DBs
Amino Acid Sequences MGAVVSCIQGALRSLGGCLMAIVNGIGGILQAIISGIVSIFDAIISCLTCGGFSRRRGVGTSTTTTPRTTRRHGLRRTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.07
6 0.06
7 0.05
8 0.05
9 0.04
10 0.04
11 0.03
12 0.03
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.05
38 0.11
39 0.16
40 0.19
41 0.24
42 0.25
43 0.27
44 0.29
45 0.31
46 0.31
47 0.31
48 0.33
49 0.32
50 0.34
51 0.35
52 0.35
53 0.35
54 0.38
55 0.39
56 0.42
57 0.49
58 0.55
59 0.64
60 0.73