Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PLA9

Protein Details
Accession J3PLA9    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-28PQPPAPRRSERIKSLKRQAVPHydrophilic
NLS Segment(s)
PositionSequence
82-88GRGRPKK
106-166LKRGPKKSAGKKGVPANTTPKRGRGHPKKEPDIAKIPVPLPKIGKAAQAISGPSKRGRGHL
215-215R
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MTPPPDAPQPPAPRRSERIKSLKRQAVPLSSQDAPPNKRIRFVREVAEPPTVQTGTKTTRPKSGSSCTLPKKDEDAAETGRGRGRPKKETMANEFPSKEGEADATLKRGPKKSAGKKGVPANTTPKRGRGHPKKEPDIAKIPVPLPKIGKAAQAISGPSKRGRGHLKEPSTDKSTSVQQQPPDNRRGIRKGAPAVIKSASISPTPPAALPVPGRRRGRSQRQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.7
4 0.69
5 0.73
6 0.75
7 0.79
8 0.82
9 0.84
10 0.77
11 0.76
12 0.72
13 0.68
14 0.61
15 0.55
16 0.5
17 0.43
18 0.42
19 0.41
20 0.43
21 0.39
22 0.43
23 0.48
24 0.44
25 0.5
26 0.52
27 0.53
28 0.53
29 0.53
30 0.5
31 0.49
32 0.52
33 0.48
34 0.48
35 0.4
36 0.33
37 0.34
38 0.29
39 0.22
40 0.19
41 0.21
42 0.21
43 0.29
44 0.35
45 0.33
46 0.4
47 0.43
48 0.46
49 0.47
50 0.49
51 0.48
52 0.47
53 0.55
54 0.53
55 0.57
56 0.54
57 0.49
58 0.46
59 0.42
60 0.37
61 0.31
62 0.28
63 0.24
64 0.27
65 0.26
66 0.23
67 0.23
68 0.24
69 0.25
70 0.28
71 0.32
72 0.34
73 0.38
74 0.45
75 0.49
76 0.53
77 0.57
78 0.59
79 0.56
80 0.53
81 0.49
82 0.42
83 0.37
84 0.3
85 0.22
86 0.13
87 0.11
88 0.08
89 0.11
90 0.11
91 0.11
92 0.12
93 0.14
94 0.17
95 0.19
96 0.19
97 0.25
98 0.35
99 0.43
100 0.52
101 0.56
102 0.56
103 0.59
104 0.65
105 0.62
106 0.53
107 0.46
108 0.45
109 0.44
110 0.48
111 0.44
112 0.43
113 0.4
114 0.45
115 0.53
116 0.55
117 0.59
118 0.61
119 0.69
120 0.69
121 0.74
122 0.71
123 0.65
124 0.61
125 0.53
126 0.46
127 0.4
128 0.35
129 0.32
130 0.3
131 0.27
132 0.23
133 0.24
134 0.25
135 0.23
136 0.25
137 0.22
138 0.22
139 0.22
140 0.21
141 0.19
142 0.21
143 0.22
144 0.21
145 0.21
146 0.26
147 0.24
148 0.29
149 0.37
150 0.39
151 0.46
152 0.54
153 0.57
154 0.58
155 0.61
156 0.61
157 0.56
158 0.5
159 0.42
160 0.36
161 0.37
162 0.38
163 0.41
164 0.4
165 0.4
166 0.49
167 0.57
168 0.6
169 0.6
170 0.58
171 0.55
172 0.58
173 0.59
174 0.57
175 0.55
176 0.56
177 0.56
178 0.57
179 0.59
180 0.52
181 0.5
182 0.44
183 0.37
184 0.31
185 0.28
186 0.23
187 0.18
188 0.18
189 0.17
190 0.18
191 0.18
192 0.17
193 0.17
194 0.17
195 0.2
196 0.25
197 0.33
198 0.39
199 0.47
200 0.53
201 0.54
202 0.63
203 0.69