Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PKL4

Protein Details
Accession J3PKL4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
92-113APKGGKPPPKKHQSARSNRPVAHydrophilic
NLS Segment(s)
PositionSequence
87-109PRVPNAPKGGKPPPKKHQSARSN
Subcellular Location(s) cyto 9, nucl 8, mito 6, pero 4
Family & Domain DBs
Amino Acid Sequences MDFPTVIARQLEKLHQRQVEDAAARYETGVAVLRAAAESLAPLQSPAQKRAGEALWRKLRCTLVESVLGQKGEGGPPPPQVARAAMPRVPNAPKGGKPPPKKHQSARSNRPVAGGANPAPIKTGCALTPVGPGKPESDGAAKHPVRATGVVAAVRPTPEPETEQVTSPSEMEVDSPAKAGAPKEGWPTPPPSSPAPLPLSFAEAAARPALPSAGPDVPNEVAGPVSGPDAQQVTKLVEAAIRSASGCEHLGKLNPAARKKLYQQALGHRARARGMLLNAQQVPELRARATAALEANLRAMKKLGWKGDQDPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.5
4 0.5
5 0.5
6 0.49
7 0.42
8 0.38
9 0.32
10 0.29
11 0.27
12 0.24
13 0.2
14 0.13
15 0.12
16 0.12
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.07
24 0.05
25 0.05
26 0.06
27 0.07
28 0.07
29 0.07
30 0.09
31 0.17
32 0.21
33 0.24
34 0.29
35 0.29
36 0.29
37 0.34
38 0.36
39 0.37
40 0.39
41 0.46
42 0.49
43 0.5
44 0.5
45 0.5
46 0.49
47 0.42
48 0.4
49 0.35
50 0.29
51 0.32
52 0.32
53 0.32
54 0.32
55 0.3
56 0.25
57 0.21
58 0.19
59 0.16
60 0.17
61 0.15
62 0.14
63 0.16
64 0.19
65 0.19
66 0.19
67 0.18
68 0.19
69 0.2
70 0.23
71 0.25
72 0.25
73 0.27
74 0.27
75 0.31
76 0.31
77 0.31
78 0.3
79 0.31
80 0.31
81 0.36
82 0.44
83 0.48
84 0.55
85 0.62
86 0.67
87 0.72
88 0.76
89 0.77
90 0.78
91 0.79
92 0.81
93 0.82
94 0.82
95 0.77
96 0.71
97 0.64
98 0.55
99 0.45
100 0.37
101 0.3
102 0.21
103 0.22
104 0.21
105 0.19
106 0.19
107 0.18
108 0.16
109 0.13
110 0.13
111 0.08
112 0.1
113 0.11
114 0.1
115 0.16
116 0.16
117 0.16
118 0.15
119 0.15
120 0.14
121 0.15
122 0.14
123 0.11
124 0.11
125 0.12
126 0.14
127 0.23
128 0.22
129 0.23
130 0.23
131 0.22
132 0.21
133 0.21
134 0.19
135 0.11
136 0.12
137 0.1
138 0.1
139 0.1
140 0.09
141 0.09
142 0.09
143 0.08
144 0.08
145 0.09
146 0.11
147 0.11
148 0.16
149 0.16
150 0.17
151 0.17
152 0.17
153 0.17
154 0.15
155 0.14
156 0.09
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.07
165 0.08
166 0.08
167 0.09
168 0.1
169 0.12
170 0.16
171 0.18
172 0.2
173 0.21
174 0.26
175 0.26
176 0.26
177 0.27
178 0.25
179 0.26
180 0.25
181 0.29
182 0.28
183 0.25
184 0.26
185 0.23
186 0.24
187 0.21
188 0.2
189 0.16
190 0.12
191 0.12
192 0.1
193 0.1
194 0.07
195 0.07
196 0.07
197 0.06
198 0.06
199 0.09
200 0.12
201 0.13
202 0.13
203 0.16
204 0.16
205 0.17
206 0.16
207 0.12
208 0.08
209 0.07
210 0.08
211 0.05
212 0.06
213 0.06
214 0.06
215 0.07
216 0.09
217 0.09
218 0.1
219 0.11
220 0.11
221 0.11
222 0.12
223 0.11
224 0.11
225 0.11
226 0.11
227 0.1
228 0.09
229 0.09
230 0.09
231 0.09
232 0.1
233 0.11
234 0.11
235 0.11
236 0.13
237 0.15
238 0.17
239 0.21
240 0.24
241 0.29
242 0.31
243 0.36
244 0.38
245 0.41
246 0.44
247 0.49
248 0.5
249 0.52
250 0.54
251 0.58
252 0.65
253 0.63
254 0.63
255 0.58
256 0.54
257 0.47
258 0.43
259 0.35
260 0.31
261 0.3
262 0.32
263 0.31
264 0.36
265 0.35
266 0.34
267 0.33
268 0.28
269 0.28
270 0.24
271 0.23
272 0.17
273 0.18
274 0.19
275 0.19
276 0.19
277 0.2
278 0.18
279 0.19
280 0.2
281 0.19
282 0.2
283 0.21
284 0.2
285 0.17
286 0.17
287 0.17
288 0.25
289 0.32
290 0.37
291 0.4
292 0.45