Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Y5J6

Protein Details
Accession A0A2B7Y5J6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
197-222DAQGRHNGRLRNHRKRPKVKGDCVILBasic
NLS Segment(s)
PositionSequence
204-215GRLRNHRKRPKV
Subcellular Location(s) cyto_nucl 11.833, nucl 11, cyto 8.5, cyto_mito 8.332, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR041841  Rsr1  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd04177  RSR1  
Amino Acid Sequences MTSTLRLQPRREYHIVVLGAGGVGKSCLTAQFVQNVWIESYDPTIEDSYRKLIDVDGRQCVLEILDTAGTEQFSEELYMKQGQGFLLVFSITSMSSLNELAELREQIIRIKDDENVPIVIVGNKSDLEEDRAVSRSRAFALSQQWGNSPYYETSARRRANVNEVFVDLCRQIIRKDIQSSQERNLDQAINGRLGAIDAQGRHNGRLRNHRKRPKVKGDCVIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.51
3 0.41
4 0.34
5 0.25
6 0.21
7 0.16
8 0.13
9 0.05
10 0.05
11 0.04
12 0.05
13 0.05
14 0.06
15 0.1
16 0.12
17 0.14
18 0.19
19 0.2
20 0.23
21 0.24
22 0.24
23 0.21
24 0.19
25 0.18
26 0.14
27 0.15
28 0.12
29 0.11
30 0.11
31 0.12
32 0.12
33 0.13
34 0.14
35 0.16
36 0.16
37 0.16
38 0.15
39 0.15
40 0.22
41 0.28
42 0.3
43 0.29
44 0.29
45 0.29
46 0.28
47 0.27
48 0.2
49 0.12
50 0.09
51 0.07
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.06
62 0.07
63 0.07
64 0.09
65 0.1
66 0.1
67 0.1
68 0.11
69 0.09
70 0.1
71 0.1
72 0.08
73 0.07
74 0.07
75 0.06
76 0.05
77 0.06
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08
93 0.09
94 0.11
95 0.11
96 0.11
97 0.12
98 0.13
99 0.14
100 0.15
101 0.14
102 0.12
103 0.11
104 0.1
105 0.09
106 0.09
107 0.07
108 0.07
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.1
115 0.1
116 0.11
117 0.11
118 0.13
119 0.14
120 0.14
121 0.14
122 0.12
123 0.13
124 0.13
125 0.12
126 0.14
127 0.18
128 0.22
129 0.23
130 0.22
131 0.22
132 0.23
133 0.23
134 0.19
135 0.17
136 0.13
137 0.15
138 0.18
139 0.19
140 0.24
141 0.33
142 0.34
143 0.35
144 0.38
145 0.38
146 0.44
147 0.47
148 0.43
149 0.35
150 0.34
151 0.32
152 0.29
153 0.27
154 0.18
155 0.14
156 0.12
157 0.12
158 0.11
159 0.17
160 0.21
161 0.25
162 0.3
163 0.34
164 0.41
165 0.48
166 0.52
167 0.5
168 0.53
169 0.47
170 0.44
171 0.42
172 0.35
173 0.28
174 0.3
175 0.27
176 0.21
177 0.2
178 0.19
179 0.16
180 0.15
181 0.15
182 0.1
183 0.1
184 0.11
185 0.13
186 0.2
187 0.21
188 0.24
189 0.3
190 0.34
191 0.39
192 0.49
193 0.57
194 0.62
195 0.72
196 0.79
197 0.85
198 0.9
199 0.94
200 0.94
201 0.94
202 0.92