Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7WH11

Protein Details
Accession A0A2B7WH11    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APAASSGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-24GGKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 20, cyto_nucl 13.166, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAASSGGKKQKKKWSKGKVKDKANHAVVLDKTTSEKLYKDVQSYRLITVATLVDRLKINGSLARKALSDLEEKGQIKKVVGHSKMNIYSTSNSVPALLQSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.86
5 0.91
6 0.93
7 0.92
8 0.92
9 0.88
10 0.85
11 0.83
12 0.74
13 0.66
14 0.55
15 0.51
16 0.41
17 0.36
18 0.29
19 0.2
20 0.18
21 0.17
22 0.18
23 0.14
24 0.13
25 0.14
26 0.2
27 0.22
28 0.24
29 0.26
30 0.28
31 0.32
32 0.33
33 0.3
34 0.25
35 0.22
36 0.18
37 0.16
38 0.13
39 0.08
40 0.09
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.09
47 0.1
48 0.11
49 0.14
50 0.15
51 0.15
52 0.16
53 0.15
54 0.16
55 0.16
56 0.15
57 0.15
58 0.15
59 0.16
60 0.22
61 0.22
62 0.24
63 0.27
64 0.26
65 0.25
66 0.28
67 0.34
68 0.37
69 0.41
70 0.44
71 0.42
72 0.48
73 0.51
74 0.47
75 0.41
76 0.35
77 0.33
78 0.31
79 0.31
80 0.25
81 0.21
82 0.2
83 0.19