Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XS94

Protein Details
Accession A0A2B7XS94    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MSVLRNGKNRLKRNQEDEKGYYKKRKDQEKWKKRKQTCYCIIMHydrophilic
NLS Segment(s)
PositionSequence
19-35KGYYKKRKDQEKWKKRK
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSVLRNGKNRLKRNQEDEKGYYKKRKDQEKWKKRKQTCYCIIMNYCKLMKLSLFCDTDIKYQESFPPPDCFDKLSLDQEWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.77
4 0.73
5 0.72
6 0.68
7 0.67
8 0.67
9 0.61
10 0.62
11 0.63
12 0.69
13 0.7
14 0.74
15 0.79
16 0.81
17 0.87
18 0.89
19 0.92
20 0.88
21 0.9
22 0.88
23 0.87
24 0.83
25 0.78
26 0.69
27 0.62
28 0.58
29 0.51
30 0.42
31 0.34
32 0.27
33 0.22
34 0.2
35 0.17
36 0.15
37 0.13
38 0.15
39 0.19
40 0.2
41 0.19
42 0.22
43 0.23
44 0.26
45 0.26
46 0.26
47 0.2
48 0.2
49 0.26
50 0.29
51 0.31
52 0.3
53 0.32
54 0.33
55 0.37
56 0.38
57 0.34
58 0.31
59 0.34
60 0.35
61 0.34